KEGG   Streptomyces glaucescens: SGLAU_15460Help
Entry
SGLAU_15460       CDS       T03327                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00520  Amino sugar and nucleotide sugar metabolism
sgu01100  Metabolic pathways
sgu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGLAU_15460
Enzymes [BR:sgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SGLAU_15460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AIR99075
UniProt: A0A089YZK7
Position
3545816..3547054
Genome map
AA seq 412 aa AA seqDB search
MTATPPATRDSIGQRLRRGPRPATDFPHPATDGIPLILTGANLVLPTGTVRNGRLAVDGT
RIAADAPDGAHVLDVSGHWLVPGFVDLHNHGGGGAGFTSGTLEDVLRGIHTHRTHGTTTL
VASTVTGDLRFLAERAGLLSELAEQGDIAGIHFEGPFISPCRKGAHSEELLRDPDPARVR
KLVEAARGHAKMVTLATELPGGLDSVRLLADHGVIAAVGHTDATYEQTVAAIDAGATVAT
HLFNAMPALGHRAPGPIAALLEDERVTVELINDGTHLHPAALELAFHHAGAGRVAFITDA
MDAAGFGDGRYMLGPLEVEVADGVARLVEGGSIAGSTLTLDRAFKRAVTVDRLPVEDVVA
AISANPARLLGMDDRIGSLEPGKDADLVLLDADFELTGVMRRGAWVVRPQLG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcaacgccgccagcgacgcgggacagcatcggtcagcggctgcgccgcgggccg
cgaccagccacggacttcccgcaccccgccacggacgggatcccgctgatcctgaccggt
gcgaacctcgtcctgcccacggggaccgtgcggaacggccggctggccgtcgacggcacc
cgcatcgccgccgacgcaccggacggcgcccacgtcctcgacgtgtccggccactggctc
gtccccggcttcgtcgaccttcacaaccacggcggcggcggagccggcttcaccagcggc
accctcgaagacgtcctgcggggcatccacacccaccgcacccacggcaccaccaccctg
gtcgcctccacggtcaccggcgacctgcgcttcctcgccgagcgcgccgggctgctcagc
gaactcgccgagcagggcgacatcgcgggcatccacttcgagggcccgttcatctccccg
tgccgcaagggcgcccactccgaggagctgctgcgcgatccggacccggcgcgggtgcgc
aagctggtcgaggcggcgcgcggccacgcgaagatggtcaccctggccaccgagctgccg
ggcggcctcgactccgtacgcctcctcgcggaccacggggtgatcgcggcggtcggccac
accgacgcgacgtacgagcagaccgtggcggccatcgacgcgggcgccaccgtcgccacc
cacctgttcaacgcgatgcccgcgctcggccaccgcgcccccggcccgatcgcggccctg
ctggaggacgagcgggtcaccgtcgagctgatcaacgacggcacccacctccacccggcc
gccctggagctggcgttccatcacgcgggcgccggacgggtcgcgttcatcaccgacgcg
atggacgcggcgggcttcggcgacggccgctacatgctcggcccgctggaggtcgaggtc
gccgacggggtggcccggctcgtggagggcggctcgatcgcgggctccaccctcaccctg
gaccgcgccttcaagcgggcggtgaccgtcgaccggctgcccgtggaggacgtcgtcgcg
gccatctccgcgaacccggcccggctgctcgggatggacgaccgcatcggctccctggag
cccggcaaggacgccgacctggtgctgctggacgccgacttcgagctgacgggcgtgatg
cgccgcggcgcctgggtggttcggccccaactggggtga

DBGET integrated database retrieval system