KEGG   Streptomyces glaucescens: SGLAU_17040Help
Entry
SGLAU_17040       CDS       T03327                                 

Definition
(GenBank) Putative 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00030  Pentose phosphate pathway
sgu00480  Glutathione metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
sgu01200  Carbon metabolism
Module
sgu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sgu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SGLAU_17040
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SGLAU_17040
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SGLAU_17040
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SGLAU_17040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD 2-Hacid_dh_C F420_oxidored PAD_porph 3HCDH_N NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: AIR99374
UniProt: A0A089XE13
Position
3884811..3885686
Genome map
AA seq 291 aa AA seqDB search
MELGLIGLGKMGGNMRERIRRAGHTVVGYDRNPDLADVHSLEELVGKLKGPRVVWVMVPA
GAATQSTIDRLAELLEPGDIVVDGGNSRWTDDEKHAAELAAKGIGFVDCGVSGGVWGLEN
GYALMYGGDKEHVARVQPIFDALKPEGDFGSVHAGKVGAGHFAKMVHNGIEYAMMQAYAE
GWELLEKVDSVENVREVFRSWQEGTVIRSWLLDLAVNALDEDEHLDELRGYAQDSGEGRW
TVEAAIDNAVPLPAITASLFARFASRQEDSPQMKMIAALRNQFGGHAVEKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggagctcggtctcatcggcctcggcaagatgggcggcaacatgcgcgagcggatccgc
cgcgcgggccacaccgtcgtcggctacgaccgcaaccccgacctcgccgatgtccacagc
ctggaagagctcgtgggcaagctcaagggcccgcgcgtggtctgggtcatggtcccggcg
ggcgcggccacccagtcgaccatcgaccggctcgccgagctgctggagcccggcgacatc
gtcgtggacggcggcaactcgcgctggacggacgacgagaagcacgccgcggagctggcc
gccaagggcatcggcttcgtcgactgcggcgtctccggcggcgtctggggcctggagaac
gggtacgcgctgatgtacggcggcgacaaggagcacgtcgccagggtgcagccgatcttc
gacgcgctgaagccggagggcgacttcggctcggtacacgccggcaaggtcggcgcgggc
cacttcgcgaagatggtccacaacggcatcgagtacgccatgatgcaggcctacgccgag
ggctgggagctgctggagaaggtggactccgtggagaacgtccgcgaggtcttccgctcc
tggcaggagggcacggtcatccgttcctggctgctggacctggcggtcaacgccctcgac
gaggacgagcacctggacgagctgcgcggttacgcacaggactccggcgagggccggtgg
accgtggaggccgccatcgacaacgccgtgccgctgcccgcgatcacggcttccctgttc
gcccggttcgcctcgcggcaggaggactcgccgcagatgaagatgatcgccgcgctgcgc
aaccagttcggcggccacgcggtcgagaagaagtag

DBGET integrated database retrieval system