KEGG   Streptomyces glaucescens: SGLAU_25510Help
Entry
SGLAU_25510       CDS       T03327                                 

Definition
(GenBank) putative ketoacyl ACP/CoA reductase-like protein
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Organism
sgu  Streptomyces glaucescens
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SGLAU_25510
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.413  A-factor type gamma-butyrolactone 1'-reductase (1S-forming)
     SGLAU_25510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 3HCDH_N 2-Hacid_dh_C F420_oxidored THF_DHG_CYH_C Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AIS01040
UniProt: A0A089XIM2
Position
5810537..5811295
Genome map
AA seq 252 aa AA seqDB search
MLLDGKTIMITGCSSGIGAAAARLFAAEGAHVVLMARREQRLRELAAEIEENGGSALPAP
GDVTREQDVARTVEEAVRRFGRLDGAFNNAGWACVGKPLHEIDQADYERVMDVNVRGVWN
CLRRQIPAMLADGQGGSIVNTSSVAGVLAPGSGAPYVAAKHAVLGLTRAAAADYGERGIR
VNALVVGSVRTELMEEVLSEDPRLEEPFVRRAPQRRMAAPHEVAEAAAWLLAGRASFVTG
AAMAVDGGWTAA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggacggcaagaccatcatgatcaccggttgctccagcggcatcggagccgcc
gccgcccggctgttcgccgcggagggcgcccacgtcgtgctgatggcccggcgcgagcag
cggctgcgcgaactggcggcagagatcgaggagaacgggggatcggcgctgcccgcgccg
ggcgacgtcacccgcgagcaggacgtcgcccggaccgtggaggaggcggtgcgccggttc
ggccggctggacggggcgttcaacaacgccggctgggcctgtgtgggcaaaccgctccac
gagatcgaccaggccgactacgagcgcgtcatggacgtgaacgtgcgcggcgtgtggaac
tgcctgcggcggcagataccggccatgctcgccgacgggcagggcggttcgatcgtgaac
acctccagtgtggcgggggtgctggcaccgggctcgggagcaccgtacgtggccgccaag
cacgcggtgctgggcctgacccgcgccgccgcggccgactacggcgagcgcggcatccgg
gtcaacgccctggtggtgggcagtgtcaggaccgagctgatggaggaagtgctcagcgag
gacccgcggttggaggagcccttcgtgcgccgcgccccccagcggcgcatggcggcgccc
cacgaggtcgccgaggccgcggcctggctgctggcgggccgcgcctcgttcgtcaccggt
gccgccatggcggtggacggcggctggaccgccgcctga

DBGET integrated database retrieval system