KEGG   Streptomyces glaucescens: SGLAU_26100Help
Entry
SGLAU_26100       CDS       T03327                                 

Definition
(GenBank) putative germacradienol/geosmin synthase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00909  Sesquiterpenoid and triterpenoid biosynthesis
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    SGLAU_26100
Enzymes [BR:sgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     SGLAU_26100
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     SGLAU_26100
    4.2.3.75  (-)-germacrene D synthase
     SGLAU_26100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: AIS01158
UniProt: A0A089XB00
Position
5952344..5954521
Genome map
AA seq 725 aa AA seqDB search
MTQPFELPHFYMPYPARLNPHLDTARAHSTAWAREMGMLEGSGIWEQADLDAHDYGLLCA
YTHPDCDAEALALITDWYVWVFFFDDHFLETFKRSQDRAGGKAYLDRLPLFMPLEPGTPV
PEPRNPVEAGLADLWARTVPSMSAGWRRRFAVATEHLLNESLWELSNINEGRIANPVEYI
EMRRKVGGAPWSAGLVEYATAEVPASVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEEE
GENSNGVLVLETFFGCTTQEAADTVNDVLSSRLHQFEHTALTEVPALALEKGLTPAEVAA
VAAYTKGLQDWQSGGHEWHLRSSRYMNENAVAPGGPGPGVLGTSATDVRALLASTGARRL
RAWTHRPFQKVGPSRIPDIRMPYPLRLNAGLDGARARLLPWTRKMGMLSEGVWDEDKLAA
YDLALCSAGLDPDGSETALDLSAQWLAFGTYGDDYYPLVYGHRRDLAAARLTTERLSACM
PLAGEEPIVPVNAMERSLIDLWGRTTAGMDEESRRGLKNAVDVMTRSWVWEVSNQLQHRI
PDPVDYLEMRRATFGSDMTMSLCRMGHGPSVPPEVYRSGPVRSLENAAMDFACLLNDVFS
YQKEIEYEGEIHNAVLVVQNFFGIDYPAALDIVGDLLNQRMEQFEHVLATEIPVVCEDFS
LSAEARAGLDSYVVALQNWMAGILNWHRSVNRYKPEWLASRAHAFLPDRAPAVPVPRAPA
PAWTG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccgttcgaactcccgcacttctacatgccgtatcccgcgcggctgaacccg
cacctcgacaccgcacgcgcccactccaccgcgtgggcgcgcgagatgggcatgctggag
gggtccgggatctgggagcaggccgacctcgacgcgcacgactacggcctgctctgcgcc
tacacccaccccgactgcgacgcggaagcgctcgcgctcatcaccgactggtacgtgtgg
gtgttcttcttcgacgaccacttcctggagacgttcaagcgcagccaggaccgcgcgggc
ggcaaggcctacctggaccggctgccgctgttcatgccgcttgagccgggcacccccgtg
cccgagccgcggaacccggtcgaggcgggcctcgccgacctgtgggcgcgcaccgtgccg
tcgatgtcggccggctggcgccgccgcttcgccgtcgccaccgagcacctgctgaacgag
tccctgtgggagctgtccaacatcaacgaggggcggatcgccaaccccgtcgagtacatc
gagatgcgccgcaaggtcggcggcgccccctggtccgcggggctggtggagtacgcgacc
gccgaggtgcccgcgtccgtcgccggcacccggccgctgcgggtgctgatggagacgttc
tcggacgccgtgcacctgcgcaacgacctcttctcctaccagcgggaggtcgaggaggag
ggcgagaacagcaacggcgtcctcgtgctggagaccttcttcggctgcaccacccaggag
gccgccgacaccgtcaacgacgtcctcagctcccggctccaccagttcgagcacaccgcg
ttgaccgaagtgcccgcgctcgccttggagaaggggctcaccccggccgaggtcgcggcg
gtggccgcctacaccaagggcttgcaggactggcagtccggcggccacgagtggcacctg
cgctccagccgctacatgaacgagaacgccgtcgccccgggcgggccgggccccggcgtg
ctgggcacctcggcgaccgacgtgcgcgcgctgctcgcctccacgggcgcccggcggctg
cgggcctggacgcaccggccgttccagaaggtcggcccgtcccgcatccccgacatccgc
atgccctacccgctccggctgaacgccggcctggacggcgcgcgggcccggctgctgccg
tggacgcggaagatgggcatgctcagcgagggcgtctgggacgaggacaaactcgccgcc
tacgacctcgcgctgtgctccgccgggctggacccggacggctccgagacggccctcgac
ctcagcgcgcagtggctggccttcggcacctacggcgacgactactacccgctggtctac
gggcaccgccgcgacctcgccgccgcccggctcaccaccgagcgcctgtcggcctgcatg
ccgctcgccggcgaggagccgatcgtccccgtcaacgccatggagcgcagcctcatcgac
ctgtgggggcgcaccaccgccggcatggacgaggagtcccgccgtggcctgaagaacgcc
gtggacgtgatgacgcggtcctgggtgtgggaggtgtcgaaccagctccagcaccgcatc
cccgaccccgtcgactacctggagatgcgccgcgccaccttcggctccgacatgaccatg
agcctgtgccgcatgggccacggcccctcggtcccgccggaggtctaccgcagcgggccg
gtccgctccttggagaacgcggccatggacttcgcctgcctcctcaacgacgtgttctcc
taccagaaggagatcgagtacgagggcgagatccacaacgcggtgctggtcgtgcagaac
ttcttcggcatcgactacccggccgccctggacatcgtcggcgacctgctgaaccagcgc
atggaacagttcgagcacgtgctcgccaccgagatccccgtggtgtgcgaggacttctcc
ctctcggccgaggcgcgggccggactggactcgtacgtcgtcgcgctgcagaactggatg
gcgggcatcctcaactggcaccgctcggtgaaccgctacaagcccgagtggctggcgagc
cgcgcccacgccttcctcccggaccgcgcccccgccgtgccggtccccagggccccggcc
cccgcgtggaccggctga

DBGET integrated database retrieval system