KEGG   Streptomyces glaucescens: SGLAU_26810Help
Entry
SGLAU_26810       CDS       T03327                                 

Definition
(GenBank) putative malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00620  Pyruvate metabolism
sgu00630  Glyoxylate and dicarboxylate metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGLAU_26810
   00630 Glyoxylate and dicarboxylate metabolism
    SGLAU_26810
Enzymes [BR:sgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SGLAU_26810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI ATPase
Motif
Other DBs
NCBI-ProteinID: AIS01300
UniProt: A0A089XJD6
Position
complement(6116014..6117639)
Genome map
AA seq 541 aa AA seqDB search
MSTPAPSTLAIVDAEPLPRQDEVLTDAALAFVAELHRRFTPRRDELLARRAERRAEIART
STLDFLPETAAIRADDSWKVAPAPAALNDRRVEITGPTDRKMTINALNSGARVWLADFED
ASAPTWENVVLGQLNLIDAYTRSIDFTDERTGKSYALRPDEELATVVMRPRGWHLSERHL
VDAEGRPVPGALVDFGLYFFHNAQRLLDLGKGPYFYLPKTESHLEARLWNDVFVFAQDHV
GIPQGTIRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGERFVL
PDRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRKDPEVNKVAFEKVRADKD
REANDGFDGSWVAHPDLVPIAMECFDKVLGDKPNQKDRLREEVDVKAEDLIAIDSLDAKP
TYHGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVVLDNGER
VTAELARKVAAEELAAVRAEIGEEAFAAGHWQQAHDLLLEVSLDEDYADFLTLPAYERLK
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaccagcgccgtccacgctggccatcgtcgacgccgagcccctgccccgccag
gacgaggtcctcaccgacgcggcgctcgccttcgtggccgagctgcaccggcgtttcacg
ccgcgccgtgacgaactcctcgcccgccgggccgagcgccgcgccgagatcgcccgcacc
tccacgctcgacttcctcccggagaccgccgcgatccgcgcggacgactcctggaaggtg
gcccccgctccggccgcgctgaacgaccgccgggtcgagatcaccggccccaccgaccgc
aagatgaccatcaacgccctcaactcgggcgcccgggtctggctcgcggacttcgaggac
gcctccgcccccacctgggagaacgtcgtcctcggccagctcaacctgatcgacgcctac
acccggagcatcgacttcacggacgagcgcaccggcaagtcgtacgccctgcgtcccgac
gaggagctggcgacggtcgtcatgcgcccgcgcggctggcacctgagcgagcgtcacctc
gtcgacgcggaaggccgcccggtccccggcgccctcgtcgacttcggcctgtacttcttc
cacaacgcccagcgcctgctcgacctcggcaagggcccctacttctacctcccgaagacc
gagtcgcacctggaggcccgcctctggaacgacgtgttcgtcttcgcgcaggaccacgtc
ggcatcccgcagggcaccatccgcgcgaccgtcctcatcgagacgatcacggcggcgtac
gagatggaggagatcctctacgagctgcgcgaccacgcctccgggctgaacgcgggccgc
tgggactacctgttctcgatcgtcaagaacttccgggacggcggcgagaggttcgtcctg
ccggaccgcaacgccgtcacgatgaccgccccgttcatgcgggcgtacaccgaactcctc
gtgcgcacctgccacaagcggggcgcgcacgcgatcggcggcatggccgcgttcatcccg
tcccgcaaggaccccgaggtcaacaaggtggccttcgagaaggtccgggccgacaaggac
cgcgaggcgaacgacggcttcgacggctcctgggtcgcccacccagacctggtgccgatc
gccatggagtgcttcgacaaggtcctcggcgacaagccgaaccagaaggaccgcctgcgc
gaggaggtcgacgtcaaggcggaggacctgatcgccatcgactcgctcgacgccaagccc
acctaccacggcctggtcaacgccgtgcaggtcggcatccggtacatcgaggcctggctg
cggggcctgggcgcggtcgccatcttcaatctgatggaggacgcggccaccgccgagatc
tcccgctcgcagatctggcagtggatcaacgccggcgtcgtcctcgacaacggcgagcgg
gtcacggccgaactggcccgcaaggtcgccgccgaggaactggcggccgtccgcgcggag
atcggcgaggaggccttcgcggccggccactggcagcaggcccacgacctgctcctggag
gtctccctcgacgaggactacgccgacttcctcaccctgcccgcgtacgagcggctcaag
ggctga

DBGET integrated database retrieval system