KEGG   Streptomyces gilvosporeus: B1H19_04210Help
Entry
B1H19_04210       CDS       T05165                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00361  Chlorocyclohexane and chlorobenzene degradation
sgv00625  Chloroalkane and chloroalkene degradation
sgv01100  Metabolic pathways
sgv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B1H19_04210
   00361 Chlorocyclohexane and chlorobenzene degradation
    B1H19_04210
Enzymes [BR:sgv01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     B1H19_04210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-ProteinID: ARF53474
UniProt: A0A1V0TKL6
Position
complement(903253..903945)
Genome map
AA seq 230 aa AA seqDB search
MTEICDIEVVVFDVLGTLVDEPGGLRAEIRDALPASDDASVDELLISWQQYVELEQQRIG
QGHRPYVNTEIIDAEAAQRVADHAGLADPAAIALLATAGQRLPPWDDSVAGLERLAQRFP
VLGLSNASRTALLRLNAHAGLRWHQALSAEAVLAYKPAPEVYQLAIDAAGCPRERVLMVA
AHAWDLRGAQARGMRTAYVQRPVGDPPTSSDVFDWRFNGLDELVTTLLPR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatctgcgacatcgaggttgttgtcttcgacgtcctcggaacgctggtcgac
gaacccggcgggcttcgagcggaaatccgcgatgcgctgcccgcgtccgacgatgcgtct
gtcgacgagctgctcatctcgtggcagcagtacgtcgagctcgagcagcaacgcatcggg
caagggcaccgcccctacgtcaacaccgagatcatcgacgcagaggctgctcaacgggtg
gctgaccatgccggactcgccgatccggcggccatagccctgctggccacagcgggtcag
cgcctgcctccctgggacgactctgtcgccggtctcgagcggctcgcgcagcggttcccc
gtgctcgggctctccaatgccagccgcaccgccctgctgcggctcaacgcacatgcgggg
ctgcgctggcaccaagccttgtccgccgaagccgtcctggcctacaagccggcgccggag
gtctaccagctcgccatcgacgccgccggatgtccacgcgaacgcgtgctcatggtggcc
gcccacgcctgggacctccgcggcgctcaggcgagaggcatgcggaccgcctacgtccag
cgaccggtcggggacccgccgacgagctccgatgtcttcgactggcggttcaacggactg
gacgaactggtcaccacgctgctgccaaggtag

DBGET integrated database retrieval system