KEGG   Streptomyces gilvosporeus: B1H19_08700Help
Entry
B1H19_08700       CDS       T05165                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00260  Glycine, serine and threonine metabolism
sgv01100  Metabolic pathways
sgv01110  Biosynthesis of secondary metabolites
sgv01120  Microbial metabolism in diverse environments
sgv01130  Biosynthesis of antibiotics
sgv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B1H19_08700
Enzymes [BR:sgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     B1H19_08700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Glyco_hydro_20 Inhibitor_I48
Motif
Other DBs
NCBI-ProteinID: ARF59310
UniProt: A0A1V0U2Q0
Position
complement(1981768..1982853)
Genome map
AA seq 361 aa AA seqDB search
MANPAAGAGTTDARQHHDTQVRGFASDNYAGVHPEVLAAFALANGGHQVAYGEDDYTAHL
QRVVRSHFGPSAEAFPVFNGTGANVVALQAVTDRWGAVIAADTAHINVDEGGAPERVGGL
KLLTVPTEDGKLTPELIDRQAWGWEDEHRAMPQVVSIAQSTELGTVYTPDEVRAICEHAH
ERGMLVHLDGARIANAAATLDVPMRAFTNAVGVDILSYGATKNGAVFGEAVIVLNHDAVR
AMKHLRKLSMQLASKMRFVSVQLEALLAKDLWLRNARHANTMAQRLAAGVREIDGVEILY
PVQSNAVFARLPHDVSERLQKRFRFYFWDEAAGDVRWMCSFDTTEQDVDGFLEALREEIA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaacccggccgccggcgccggcacgaccgacgcccggcaacaccacgacacccag
gtacgcggcttcgccagcgacaactacgcgggcgtccacccggaggtcctcgccgcgttc
gccctcgccaacggcggccaccaggtcgcctacggcgaggacgactacaccgcacacctc
cagcgcgtcgtccgcagccacttcgggccgagcgccgaggcgttcccggtgttcaacggc
accggcgccaacgtcgtcgccctccaggccgtcaccgaccgctggggcgcggtgatcgcc
gccgacaccgcgcacatcaacgtcgacgagggcggcgcgcccgagcgggtcggcgggctg
aagctgctgaccgtaccgaccgaggacggcaagctcacgcccgagctgatcgaccggcag
gcgtggggctgggaggacgagcaccgcgccatgccgcaggtcgtctcgatcgcccagagc
accgagctgggcaccgtctacacccccgacgaggtgcgggcgatctgcgaacacgcccat
gagcgcggcatgttggtgcacctggacggcgcacggatagccaacgccgcggcgacgctg
gacgtcccgatgcgggccttcaccaacgccgtcggcgtcgacatcctctcctacggtgcc
accaagaacggcgcggtcttcggcgaggccgtgatcgtcctcaaccacgacgccgtacgc
gccatgaagcatctgcgcaagctgtccatgcagctggcctcgaagatgcgcttcgtctcc
gtccagctggaggccctgctggccaaggacctgtggctgcgcaacgcccggcacgccaac
accatggcgcagcgcctggccgccggggtccgggagatcgacggcgtcgagatcctctac
ccggtgcagtccaacgcggtcttcgcccggctcccgcacgacgtcagcgaacgcctccag
aagcgcttccgcttctacttctgggatgaggcggccggcgatgtgcgctggatgtgctcg
ttcgacacgacggagcaggacgtcgacggcttcctggaggcactgcgggaggaaatcgcc
cgctga

DBGET integrated database retrieval system