KEGG   Streptomyces gilvosporeus: B1H19_15535Help
Entry
B1H19_15535       CDS       T05165                                 

Definition
(GenBank) helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    B1H19_15535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sgv03400]
    B1H19_15535
Enzymes [BR:sgv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B1H19_15535
DNA repair and recombination proteins [BR:sgv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     B1H19_15535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 SH3_13 Viral_helicase1 HHH_5 AAA_11 Helicase_RecD AAA_22 PIF1 AAA_16 UvrD_C PhoH TrwB_AAD_bind HHH_2 AAA HTH_IclR AAA_12 AAA_10 DUF4880
Motif
Other DBs
NCBI-ProteinID: ARF55411
UniProt: A0A1V0TR93
Position
complement(3528630..3530837)
Genome map
AA seq 735 aa AA seqDB search
MVNGSVVEGVLERITYANEETGYTVARVDTGRGSSDLLTVVGALLGAQPGESLRMHGRWG
SHPQYGKQFTCENYTTVLPATIQGIRRYLGSGLIKGIGPRIADRIVEHFGTDTLEVIESE
PGRLVEVPGLGPKRTKMIGAAWEEQKAIKEVMVFLQGVGVSTSIAVRIYKKYGDASISVV
RNEPYRLAADVWGIGFLTADRIAQSVGIPHDSPDRVKAGLQYALSQSTDQGHCFLPEEQL
IADAVKLLQVDTGLVIDCLGELAAEPEGVVRERVPGKDGEPVTAVYLVPFHRAEISLAGR
LTRLMRSDEDRMPAFGDVVWDKALAWLARRTGAELAPEQQAAVRLALTQKVAVLTGGPGC
GKSFTVRSVVELARAKKAKVVLAAPTGRAAKRLSELTGAEASTVHRLLELKPGGDAAYDA
DRPLDADLVVVDEASMLDLLLANKLVKAVPPGAHLLLVGDVDQLPSVGAGEVLRDLLADP
GPVPSVRLTRIFRQAQQSGVVTNAHRINSGVPPLTTGLKDFFLFVEDDGEEAARLTVDVA
ARRVPAKFGLDPRRDVQVLTPMHRGPAGAGALNGLLQQAVTPARPDLAERRFGGRVFRVG
DKVTQIRNNYDKGSNGVFNGTVGVVTDLNAEEQRLTVLTDEDEEVPYDFDELDELAHAYA
VTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVTRAKRLVVLVGSRKALGQAVRTVSA
GRRCTALDHRLAGAV
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacggatcggtggtggaaggggtcctcgagcggatcacctacgccaatgaggag
accggctacaccgtcgcgcgggtcgacaccggccgcggctccagcgatctcctcacggtg
gtcggggcgttgctgggggcgcagcccggcgaatcgctgcggatgcacgggcgctggggc
tcccatccgcagtacggcaagcagttcacctgcgagaactacaccaccgtcctgccggcc
accatccagggcatccgccgctatctgggttccggtctcatcaagggcatcggcccccgg
atcgccgaccggatcgtcgagcacttcggcacggacacgctggaggtcatcgagagcgag
cccgggcggctcgtcgaggttccggggctgggccccaagcggacgaagatgatcggcgcg
gcgtgggaggagcagaaggccatcaaggaggtgatggtcttcctccagggcgtgggcgtc
tcgacgtccatcgcggtgcggatctacaagaagtacggcgacgcctccatctccgtggtc
cgcaacgagccctaccggctggccgccgacgtctggggcatcggcttcctgaccgccgac
cgcatcgcacagtcggtcggcattccgcacgacagcccggaccgggtcaaggcgggcctt
cagtacgcgctgtcgcagtcgacggaccaggggcactgcttcctgcccgaggaacagctg
atcgcggacgcggtcaagctcctccaggtggacaccggcctggtcatcgactgcctgggg
gagctggcggcggagcccgagggggtggtgcgcgagcgggtgccgggcaaggacggggag
ccggtcaccgccgtctatctggtgccgttccaccgtgcggagatctcgctggccgggcgg
ctgacccggctgatgcgcagcgacgaggaccgtatgccggcgttcggcgacgtggtctgg
gacaaggcgctggcgtggctggcgcggcgtacgggggccgagctggcgccggagcagcag
gccgcggtgcggctggcgctgacgcagaaggtggcggtgctgaccggcggtcccgggtgc
ggcaagtccttcacggtgcgctccgtggtggagctggcccgcgccaagaaggccaaggtg
gtgctggcggcgcccaccgggcgggcggccaaacggctgtcggagctgacgggggcggag
gcgtccaccgtccaccgcctcctggagctcaagccgggcggggacgccgcctatgacgcg
gaccggccgctggacgccgatctggtggtcgtcgacgaggcgtccatgctggatctgctg
ctggccaacaagctcgtcaaggcggtgccgccgggcgcccatctgctgctggtgggggac
gtcgaccagctgccgtcggtgggcgcgggggaggtgttgcgggatctgctcgccgacccg
ggcccggtgccgtccgtgcgcctgaccaggatcttccgccaggcgcagcagtcgggggtg
gtcaccaatgcgcaccgcatcaactccggggtgccgccgctgaccaccgggctgaaggac
ttcttcctgttcgtggaggacgacggtgaggaggccgcgcggctgacggtcgatgtggcg
gcgcggcgggtcccggccaagttcgggctcgatccgcgtcgggacgtccaggtcctcacc
ccgatgcaccgcggcccggccggcgccggcgccctcaacggcctgctccagcaggccgtc
acccccgcccgccccgatctggccgagcgccgcttcggcggccgggtcttccgggtgggc
gacaaggtcacccagatcaggaacaactacgacaagggaagcaacggcgtcttcaacggc
acggtgggcgtggtcacggatctgaacgccgaggagcagcggctgaccgtgctcaccgac
gaggacgaggaggtcccctacgacttcgatgaattggacgaattggcacacgcctatgcc
gtgacgatccaccgctcgcagggtagtgagtatccagcggtggtgattccggtcaccacc
ggagcgtggatgatgctccagcgcaatctgttgtataccgccgtgacccgggcgaaacgc
ttggtggtgctcgtcggctcccggaaggccctcggacaggccgtgcgcaccgtatccgcc
ggtcggcggtgtacggcgctcgatcaccggctcgccggtgcagtgtga

DBGET integrated database retrieval system