KEGG   Syntrophobotulus glycolicus: Sgly_0163Help
Entry
Sgly_0163         CDS       T01429                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sgly_0163
DNA repair and recombination proteins [BR:sgy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sgly_0163
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sgly_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 IMS_HHH HHH_8 Cdd1 Zf_RING
Motif
Other DBs
NCBI-ProteinID: ADY54534
UniProt: F0SVQ8
Position
170716..171312
Genome map
AA seq 198 aa AA seqDB search
MDFFYYPQPLADLIAAFSRLPGIGPKTAGRLAFYALQHADEATGLSKAISAALKDIRYCS
ICGNYTDSDPCRICSSPKRNREILCVVEQSRDVVALEKTGEYKGLYHVLHGVLSPMEGIG
PEQLNIGGLLSRLEGVSEIVIAVNPTVEGEATALYLARLLKPLQIKVTRIAHGLPVGADL
EYADEVTIARALEGRRPL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattttttttattatcctcagcctttggctgatttaattgcagcgttttcaagactg
cccggcatagggccaaagactgccggcagattggcattttatgccctccagcatgcagat
gaagctaccggactttcaaaggccatcagtgccgcccttaaggatattcggtattgcagt
atttgcggtaattatacagattccgatccctgccggatatgttccagtccaaaacgaaac
agggaaattctttgtgtggtcgagcagtcccgggatgttgtggccctggagaagactggg
gaatacaagggattgtaccatgttctgcacggggtgctttctcctatggaagggataggg
ccggaacagcttaatattggtggtctgttgtccagactggaaggagtcagtgaaatcgta
attgcggttaaccctactgttgaaggagaagctacggctttgtatctggccaggttgctt
aagcctttgcagataaaggtcaccagaattgcgcacgggctgcctgttggcgctgatctg
gaatatgctgatgaagtgacaattgccagagcattggaaggaagaagaccgctgtaa

DBGET integrated database retrieval system