KEGG   Syntrophobotulus glycolicus: Sgly_0264Help
Entry
Sgly_0264         CDS       T01429                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00051  Fructose and mannose metabolism
sgy01100  Metabolic pathways
sgy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Sgly_0264
Enzymes [BR:sgy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Sgly_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADY54633
UniProt: F0SWU3
Position
291580..292209
Genome map
AA seq 209 aa AA seqDB search
MSTHIDSEISDRIRTLRRELVAVSKDIYERKLSSGICGNLSARVPDCKNLMLIKASGKSF
KDMAEHDFLLADMEQNLYEGEGKPSIEIKFHAGIYKARPEVNAVIHGHASYTTAVGTIMK
SLKVITVDAEVGLKQIGIVDYAEAGSAELAEGVINVFKMEEINAALLRRHGFITVGKDMR
QAYYLADTLEEYAKTAYLMEMLSPGYTSK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacccacatagatagtgaaatatcagatagaataaggaccttacgcagagaactc
gtagctgtcagtaaagatatttatgagcggaagctttcttcaggaatctgcggcaattta
agcgcaagagtaccggactgtaaaaacctaatgttgattaaggccagcggaaagagcttt
aaggacatggccgaacatgattttctgcttgcggatatggaacaaaatttatacgagggc
gaagggaaaccttccattgaaataaagtttcatgcaggcatttacaaagccagacctgaa
gtaaacgctgttattcatggccatgcttcctatacgacagcagtaggcacaataatgaaa
agcctaaaggtaataacggtagatgcggaagttggcttaaaacaaatagggatagtggac
tatgcggaagccggttcagcagaattggcagagggggttatcaatgtttttaaaatggag
gaaattaatgcggctttgctgcgaaggcatggattcataaccgtggggaaagatatgagg
caggcatactatcttgcggatacactggaggaatatgccaagacggcttatttgatggaa
atgttatcaccaggttatactagtaaatga

DBGET integrated database retrieval system