KEGG   Syntrophobotulus glycolicus: Sgly_1783Help
Entry
Sgly_1783         CDS       T01429                                 

Definition
(GenBank) Cellulase
Organism
sgy  Syntrophobotulus glycolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ADY56080
UniProt: F0SZJ4
Position
complement(1809132..1810190)
Genome map
AA seq 352 aa AA seqDB search
MNHENFAEEILFKLADCSAISGFEQKSLSALQSVFASLAAEAARDPMGNTTFLKKGGAGR
GKIMLAAHFDEIGLMITGMDERGILTFTPVGGIDHKTLLNQTVIVHGRRDLKGIICYEPR
SLLRETERNIAVPSSRMGIDLGLPAAKVRELIRPGDIVSIEGRNLRLLNGLASGKAFDNR
AGITAMAVCLRELTRLRHAHDVYAVATVQEEVGLRGAAVSSHQIEPDIAFILDVTHAQTT
DSKDKVKVALGKGPVIALGPNIHSGLLRYVRTCAKDHRIPVQLDPTPRATGTDARVIQLT
GAGIPTALLSVPLRYMHSSIETISLSDIVSCGILLAQLIANLPEDLEEILCF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgaaaactttgctgaagagatattatttaagcttgccgattgcagcgcaata
tccggttttgagcaaaaaagcctttctgctttgcaatccgtatttgcctctctggcggca
gaagctgcccgggaccctatggggaatacgacctttctgaaaaaaggcggggccggccgg
ggaaaaatcatgctggcggctcattttgatgaaataggcttgatgattaccgggatggat
gagaggggaatcttaacctttacgccggttggcggaatcgatcataaaaccttgctgaat
cagacggtgatcgttcatggcagaagggatctcaaaggaatcatctgttatgaaccgaga
tcccttctgcgggaaacagaaagaaatattgctgtgcccagctccagaatggggattgat
cttggcttgcctgcagctaaagtccgggaactgatccggcccggagacatcgtttcgata
gaaggcaggaatttacggcttctaaacggcctggccagcgggaaggcctttgataaccgg
gcaggcatcacggcgatggctgtttgcttacgggaattaaccaggctaagacatgcacat
gatgtttatgccgtagctacagttcaagaggaagtcggattgcggggcgccgccgtaagt
tcccatcaaatcgaaccggatatcgcctttatcctggatgttactcatgcccaaacaaca
gacagcaaggataaggtcaaagttgcactgggtaaagggccggtcattgctctgggcccg
aatatccacagcggtttactgcgctatgtacggacctgcgccaaggatcatagaattccg
gttcagcttgatccgacaccccgggcaacaggcacggatgcccgggtcatccagctgacc
ggagcaggaataccgactgcgctgctgagcgttcctctgcgttacatgcactcctccatt
gagacgatttccttatcggatatcgtttcctgcggaattttgctggcccaactgattgcc
aatctacctgaagacctggaggaaatcttatgcttttaa

DBGET integrated database retrieval system