KEGG   Syntrophobotulus glycolicus: Sgly_2201Help
Entry
Sgly_2201         CDS       T01429                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00010  Glycolysis / Gluconeogenesis
sgy00620  Pyruvate metabolism
sgy00640  Propanoate metabolism
sgy00680  Methane metabolism
sgy01100  Metabolic pathways
sgy01110  Biosynthesis of secondary metabolites
sgy01120  Microbial metabolism in diverse environments
sgy01130  Biosynthesis of antibiotics
sgy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sgly_2201
   00620 Pyruvate metabolism
    Sgly_2201
   00640 Propanoate metabolism
    Sgly_2201
  Energy metabolism
   00680 Methane metabolism
    Sgly_2201
Enzymes [BR:sgy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sgly_2201
Lipid biosynthesis proteins [BR:sgy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sgly_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADY56490
UniProt: F0STW7
Position
complement(2227327..2229288)
Genome map
AA seq 653 aa AA seqDB search
MALTEQERNEYKQKITNIANSFQSKKANDHLRSRTEEAEGRLEFWQERASTLSWFQKWDQ
VLEWSYPDARWFVNGKLNASYNCLDRHLDSWKKNKPALIFEGEKGDHKVYTYKELHAEVN
KFANVLKSRGVHKGEIVTIYMPMIPEAIIAMLACARLGAPHNVVFGGFSPEALRERINDT
KSRFLITCDGAYRRGNLLRVKENVCAALKEADSVEKVFIVKRANIDIEIIGGRDIWYHEA
MEEAGEDCPPEIMDSEDMLFVLYTSGSTGKPKGIVHTTGGYLTGASTTLEYVFNMKQDDV
YWCTADVGWITGHSYLVYGPLLNGATIVMYEGAPDYPSKDRYWEIVQKHGVTILYTAPTA
IRTFMKWGVSYLEKWDLSSLRILGTVGEPINPEAWNWFHKNIGGGRCPIMDTWWQTETGM
IMISPLPGTNLKPGSCVAPFPGIKAEIVDKSGQPVAPGEKGFIVITEPWPSMLRTIYNDH
ERFKQTYWNTIPGVYYAGDGAKYDEDGYFWVLGRVDDVINVSGHRIGTAEVENILIEHPV
VAEAACIGKNHEIKGQAIVAFVTLREGVCPDSDLVELAEELKKHIVLRIGAIARPEDIYL
TKELPKTRSGKIIRRILRDIAEGRMIGDTTTLDDGFNLEEVMKNILVSSKNEA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggctttgacagaacaagaaagaaatgaatacaaacaaaaaataacaaatatagcaaat
agctttcaatccaaaaaggccaatgatcatctcagaagcagaactgaggaagcggaagga
agacttgaattttggcaggaaagggcttcaacgttaagctggttccaaaaatgggatcag
gttcttgaatggagttaccctgatgccagatggtttgtcaatggaaagttaaatgcttcc
tataactgtcttgatcgccatttagacagctggaaaaagaataagccggctttgattttt
gagggggaaaaaggagaccataaggtttacacatacaaagagctgcatgccgaagtaaac
aaatttgccaatgttctcaagtcgcgcggtgtccataagggtgagattgtcacaatctat
atgcccatgattccggaagccatcatcgcaatgctggcttgcgcaagactgggagcgccg
cataatgttgttttcggcggcttcagtccggaagcattgagagagaggatcaatgacaca
aaatcaagattccttattacctgtgatggcgcttatcgcagaggaaacctcctgcgtgta
aaggaaaatgtttgtgcggccttgaaggaagcagacagtgttgaaaaggtatttatcgtt
aaacgcgccaatattgatattgaaatcattggcggccgggatatctggtatcatgaggca
atggaggaggccggtgaagactgtccgcctgaaatcatggattctgaggatatgctgttt
gttctctataccagcggttcaaccggcaaacctaaagggatcgttcatacgaccggcggc
tatctgacaggggcttcaacaaccctggaatatgtgtttaacatgaagcaagatgatgtt
tactggtgtaccgctgatgtaggctggattacaggtcacagttatcttgtttatggtccg
cttctcaacggggctacgattgtcatgtatgagggggctccggactatccgtcaaaggac
agatactgggaaattgtccagaagcatggtgtgaccattctgtacaccgcaccgaccgca
atcaggacattcatgaagtggggagtatcctatctggaaaaatgggacctttcaagcctg
agaatcctcggaacggtaggggagccaatcaaccccgaagcatggaactggttccataaa
aatattggcggcggcaggtgcccgatcatggatacctggtggcagactgaaaccggaatg
attatgatcagcccgcttcccggcaccaatctgaaacctggatcgtgtgtagctcctttt
ccggggattaaagctgaaattgttgataagagcggacagcctgttgctccgggagaaaaa
ggctttattgtcatcactgagccttggccttcaatgctgaggaccatttataatgatcat
gaaagattcaaacaaacttactggaatacgataccgggtgtttattatgccggagacggt
gcgaaatatgatgaagacgggtatttttgggtactgggccgtgtcgatgatgtcatcaat
gtctcagggcataggatcggtacagccgaggtggaaaatattctgattgaacatccggtc
gtggcggaagctgcttgtataggaaagaatcatgaaattaaagggcaggcaattgtcgct
tttgtgaccctcagagaaggtgtatgcccagattcggacttggtggagctggcggaagaa
ttgaagaaacacattgttcttcgaatcggggcgatagccagacccgaagatatttacctc
acgaaagaattgcccaaaacaagaagcggcaaaatcatcagaaggattctcagagatatt
gccgaaggcagaatgatcggagatacgacaactcttgatgacgggttcaatctggaagag
gtgatgaagaatatcctggtatccagtaaaaacgaagcttga

DBGET integrated database retrieval system