KEGG   Syntrophobotulus glycolicus: Sgly_2870Help
Entry
Sgly_2870         CDS       T01429                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00260  Glycine, serine and threonine metabolism
sgy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgy01100  Metabolic pathways
sgy01110  Biosynthesis of secondary metabolites
sgy01130  Biosynthesis of antibiotics
sgy01230  Biosynthesis of amino acids
Module
sgy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sgly_2870
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sgly_2870
Enzymes [BR:sgy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sgly_2870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADY57139
UniProt: F0SZ21
Position
complement(2909568..2910767)
Genome map
AA seq 399 aa AA seqDB search
MDKQVREGRYGVFGGRYVPETLMNALLELEKAYEFYQNDREFQEEFDRLLREYAGRPSLL
YYAEKLTEHLGGAKIYLKREDLNHTGSHKINNVLGQTLLAKKMGKKRVIAETGAGQHGVA
AATAAALFGMECQVFMGREDTERQALNVFRMNLLGSSVKAVESGTATLKDAVNEAMREWT
ARVDDTFYVLGSVMGPHPYPMMVRDFQSVIGREVREQMLAQTGKLPDCLIACVGGGSNAM
GLFYPFIEDKEVRMIGVEAGGRGVETPDHAATITKGSIGVFHGMKSYFLQDEEGQITPVY
SISAGLDYPGIGPEHAWLHATGRAEYANITDSEAVEAFQLLSKTEGIIPAIESAHAVAYA
MKIAPAMDGDKTIVINLSGRGDKDVYQIARYLEVEIDER
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaggtgcgggaaggccgttatggggtttttggcggccgttatgttccggaa
accttaatgaatgccttgcttgaattggaaaaagcttacgagttttatcaaaatgaccgg
gaatttcaggaggaatttgacaggctgctccgagaatatgccggcaggccgtcactgctc
tattatgccgaaaagctgaccgaacatctgggcggagcgaagatttatctgaaacgggaa
gatttgaaccataccggctcccataagatcaataatgttttggggcagacccttctggct
aaaaaaatggggaagaaaagggtcatagcagaaacaggcgccggacagcatggagtcgcg
gccgcaacggcggcagcgctttttggcatggaatgtcaggtttttatgggacgggaggat
accgaaagacaggccctgaatgttttccgcatgaaccttctcggttcctcggttaaggcg
gtggaatcggggacagccacgctcaaagacgcggtgaacgaggctatgcgggaatggaca
gctcgtgtggatgataccttctatgtgctgggctctgtcatggggccgcatccttatccc
atgatggtccgcgattttcaaagcgtgatcggacgtgaggtcagggaacaaatgctggcc
cagaccggtaagctgcctgattgcctgatcgcctgtgtcggcggcggcagcaatgccatg
ggtcttttctatccgttcattgaagacaaagaagtgcggatgatcggggtagaagcaggc
ggacggggagttgagacccctgatcacgcggcaacgattaccaagggcagcataggggta
tttcatggcatgaaatcttattttctgcaggatgaagaagggcagatcacacctgtctat
tccatctcggccggcctggattatccggggatcgggccggaacacgcctggctgcatgcc
accggtcgggccgaatatgcgaatattaccgatagtgaagcggttgaagcgttccaactg
ctgtcgaaaaccgaggggatcatcccggctattgaatcggctcatgccgttgcttatgcc
atgaaaatagcaccggcgatggacggggataagaccattgtcattaacctttcaggccgg
ggggacaaagatgtttaccagatagccagatatttggaggtggagatagatgagcgctga

DBGET integrated database retrieval system