KEGG   Streptomyces globosus: C0216_19325
Entry
C0216_19325       CDS       T06864                                 

Definition
(GenBank) epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
sgz  Streptomyces globosus
Pathway
sgz00525  Acarbose and validamycin biosynthesis
sgz01100  Metabolic pathways
sgz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    C0216_19325
Enzymes [BR:sgz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     C0216_19325
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AXE25312
UniProt: A0A344U341
Position
complement(4401947..4402738)
AA seq 263 aa
MTPAVAAPQWRIGTDRRRAARTALAAGADLLHLDYGGAHRGTPLGEPAALREAAAIAGDI
PVPVLAVNHVNDLGLAEERGTANPAALALLERAQDCALRLGAGVLHVPGFRRSTPATAGL
RAGTADALRTLCERAASAGLVLAYESPLGHRDLLALARRVDHPALRLVLDTGNLRDAGED
PLAFAREAGAAGLLLPDLHVKDPAAGPAAPGSAFAELPALLARSAARSVLVENDYRGAGA
ARLPEDIRLCRAAAEPTRPEDPR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccccggccgtcgccgcgccccagtggcggatcggcaccgaccggcgccgcgccgcc
cgcaccgcactcgccgccggggcggacctgctgcacctggactacggcggcgcccaccgc
ggcaccccgctcggcgaacccgccgcactgcgcgaagccgcggcgatcgccggggacatc
ccggtgccggtcctcgccgtcaaccacgtcaacgacctcggcctcgccgaggagcggggc
accgccaacccggcggcgctcgccctcctggagcgcgcccaggactgcgcgctccgcctc
ggcgccggggtgctgcacgtccccggcttccggcgcagcacgcccgccaccgcaggactg
cgcgccggcaccgccgatgccctgcgcacgctgtgcgaacgcgccgcgtcggcgggcctc
gtcctcgcctacgagtcccccctcggccaccgcgacctcctcgccctggcccgccgcgtc
gaccacccggccctgcgcctggtgctcgacaccggcaacctccgcgacgcaggcgaggac
cccctggccttcgcccgcgaggccggggcggccgggctgctcctgcccgacctgcacgtg
aaggaccccgcggccggcccggcggcccccggctcggccttcgcggaactgcccgcactg
ctggcacggtccgcggcccgctccgtgctcgtggagaacgactaccggggcgcgggggcc
gcccgcctgcccgaggacatcagactgtgccgcgccgcggccgaacccacccgacccgag
gatccacgatga

DBGET integrated database retrieval system