KEGG   Staphylococcus haemolyticus JCSC1435: SH0035Help
Entry
SH0035            CDS       T00250                                 

Gene name
kdpC
Definition
(GenBank) potassium-transporting ATPase C chain homologue
  KO
K01548  K+-transporting ATPase ATPase C chain [EC:3.6.3.12]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SH0035 (kdpC)
Enzymes [BR:sha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.12  K+-transporting ATPase
     SH0035 (kdpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpC
Motif
Other DBs
NCBI-ProteinID: BAE03344
NITE: SH0035
UniProt: Q4LAI1
Position
42191..42748
Genome map
AA seq 185 aa AA seqDB search
MQTIRKSLGLVLIMFVLCGFIFPLTVTALGQVLFPEQANGSLVKQDGKVIGSKLIGQQWT
EPKYFHGRISAVNYNMNANEVKESGGPASGGSNYGNSNPELKKRVQETIKQEGQKLSSDA
VTTSGSGLDPDITVDNAKQQVKCIAKERNIDASKINHLIDENKQASPMADDYVNVLKLNI
TLDKL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaataagaaaaagtttaggactagtactgattatgtttgttttatgcggattt
atcttcccgctgactgtcacagcgcttggacaagtattatttccagaacaagcaaacggc
agtttagtgaaacaagatggcaaagtaattggttcaaagctcattggacaacaatggaca
gaacctaaatatttccatggacgtatcagtgcagtcaattacaatatgaatgcgaatgaa
gtgaaagaaagtggcggacctgcttcaggtggctcaaactacggcaattcaaatcctgaa
ttgaaaaaaagagttcaagagactattaaacaagaaggacaaaaactttcaagtgatgcg
gtgaccacttctggctctggtttagacccagatattacggttgacaatgcgaaacaacaa
gtaaaatgcattgcgaaagaaagaaacatagatgcttcaaaaattaatcaccttattgat
gaaaacaaacaagcatcaccaatggcagatgattatgttaatgtcttaaaattgaatatc
actttagataaactctaa

DBGET integrated database retrieval system