KEGG   Staphylococcus haemolyticus JCSC1435: SH0182Help
Entry
SH0182            CDS       T00250                                 

Gene name
panC
Definition
(GenBank) pantoate beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00410  beta-Alanine metabolism
sha00770  Pantothenate and CoA biosynthesis
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
Module
sha_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SH0182 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SH0182 (panC)
Enzymes [BR:sha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     SH0182 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase ATP-sulfurylase
Motif
Other DBs
NCBI-ProteinID: BAE03491
NITE: SH0182
UniProt: Q4LA34
Position
179594..180445
Genome map
AA seq 283 aa AA seqDB search
MTKVIQTVSEMQQITQELKSTGKTIGFVPTMGALHEGHLSMMRRSVEENDITVISVFVNP
LQFGPNEDFDAYPRQIDQDVALVEAINVDYVFHPAVEEMYPNELSVTLKVGRLAEVLEGA
QRPGHFDGVVTVLNKLFNIVSPNKAYFGKKDAQQLAIVEKMVEDFNHPIQIVGIDIVREE
DGLARSSRNVYLTDDERQEAVHLSKSLEIAQTLYKQGERRSHIIVGEIKTYLSEHTSGHI
DEVAIYSYPDLEVATEIQGQIFISLAVKFSKARLIDNIILGSE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagtgattcaaaccgtatctgagatgcaacaaattacacaggaattgaagagt
acaggtaaaacgattggcttcgttccaacgatgggagccttacatgaaggtcatttgagt
atgatgcgtcgctcagttgaagagaatgatattactgtgattagtgtatttgtaaaccct
ctacaatttggtccaaacgaagatttcgatgcctatccacgtcaaattgatcaagatgta
gccttagttgaagcaattaatgttgattatgtattccatccagcagtagaagaaatgtac
ccaaacgagctaagtgtcacattaaaggtaggacgtctagcggaagtcttagaaggtgca
caacgtccaggtcatttcgatggtgtagttacggtcctaaacaagttatttaatattgtg
agtcctaataaagcatactttggtaagaaagatgcacaacagctcgcaattgttgaaaaa
atggtagaagattttaatcatccaattcaaattgtaggtattgatattgtacgtgaagag
gatggacttgcacgtagttcgcgaaatgtatatttaactgacgacgagagacaagaagct
gttcacttgagtaaaagtttggaaatagctcaaacattgtataaacaaggagaacgacgt
agccatattattgttggtgagattaagacatatttatcggaacatacaagtggtcatatt
gatgaagttgcaatttatagttaccctgatttagaagttgcgacagaaatacaaggacaa
atttttatatctttagctgttaaattctcgaaagcacgattgatagataatataatttta
ggaagtgaatag

DBGET integrated database retrieval system