KEGG   Staphylococcus haemolyticus JCSC1435: SH0232Help
Entry
SH0232            CDS       T00250                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00051  Fructose and mannose metabolism
sha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SH0232 (mtlD)
Enzymes [BR:sha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SH0232 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Sacchrp_dh_NADP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: BAE03541
NITE: SH0232
UniProt: Q4L9Y4
Position
complement(228946..230049)
Genome map
AA seq 367 aa AA seqDB search
MKAVHFGAGNIGRGFIGYILSDNNIDVTFADVNEEIINALDNEGAYNVILANEEKTTTRV
TGVSAINSGQLSDELKQAILEADIITTAVGVNILPIIAKSFAPVLKEKENHVNIVACENA
IMATDTLKEAILDITGPLGDNIHFANSAVDRIVPLQKNDNILDVMVEPFFEWVVEKDAWY
GEELEHIKYVDDLTPYIERKLLTVNTGHALLAYAGRFYGRDTVLDAVKDEAIVADLRQVL
GETSEYIVDNFSFTKEEQAAYVEKIIGRFENPYLSDEVTRVGRGTIRKIGPKDRIIKPLS
YLYENNLRRKGLLKAAALLLKYDDMNDKETIEMREYIDAHGVKAFLQEYAKINDRLADEI
VAVYEDL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtacacttcggagctggaaatattggccgtggattcatcggctatattctt
tcagataacaacattgatgtaacatttgcagacgttaatgaggaaattataaacgcatta
gataatgaaggcgcgtataacgttattcttgctaatgaagagaaaacaacaacacgcgtc
actggcgtaagtgcaattaacagtggtcaactttcagatgaattgaaacaagcaattctt
gaagctgacattattacaactgcagttggtgtgaacatccttcctatcattgcgaaatca
ttcgcaccagttttaaaagagaaagaaaatcacgtcaacatcgtcgcatgtgaaaatgca
attatggcgactgatacgcttaaagaagcaatcttagatatcactggtccattaggtgat
aacattcacttcgcgaactctgcagttgaccgtattgtcccacttcaaaagaatgacaat
attttagacgttatggttgaacctttctttgaatgggttgttgaaaaagacgcttggtat
ggtgaagagttagaacatattaaatatgttgatgatttaacaccttacatcgaacgtaaa
ttattaacagttaacactggtcatgctttattagcatatgctggtcgcttctatggtaga
gatactgtattagatgctgttaaagatgaagctatcgttgcagatttacgtcaagtatta
ggtgaaacaagcgagtacatcgttgataacttcagtttcactaaagaagaacaagcggct
tatgttgagaagattattggtcgtttcgaaaatccatacctttctgacgaagtaacacgt
gtaggtcgtggaacaattcgtaaaatcggccctaaagatcgtattatcaaacctttatct
tatttatatgaaaataatttacgtcgcaaaggcttattaaaagcagcagcgttattatta
aaatatgatgatatgaacgataaagaaacaattgaaatgcgtgaatacattgatgcacat
ggtgtgaaagcattcttacaagaatatgcgaaaatcaatgaccgcttagcagatgaaatt
gtagctgtttacgaagatctataa

DBGET integrated database retrieval system