KEGG   Staphylococcus haemolyticus JCSC1435: SH0510Help
Entry
SH0510            CDS       T00250                                 

Gene name
mvaC
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00071  Fatty acid degradation
sha00072  Synthesis and degradation of ketone bodies
sha00280  Valine, leucine and isoleucine degradation
sha00310  Lysine degradation
sha00362  Benzoate degradation
sha00380  Tryptophan metabolism
sha00620  Pyruvate metabolism
sha00630  Glyoxylate and dicarboxylate metabolism
sha00640  Propanoate metabolism
sha00650  Butanoate metabolism
sha00900  Terpenoid backbone biosynthesis
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
sha01200  Carbon metabolism
sha01212  Fatty acid metabolism
sha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SH0510 (mvaC)
   00630 Glyoxylate and dicarboxylate metabolism
    SH0510 (mvaC)
   00640 Propanoate metabolism
    SH0510 (mvaC)
   00650 Butanoate metabolism
    SH0510 (mvaC)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SH0510 (mvaC)
   00072 Synthesis and degradation of ketone bodies
    SH0510 (mvaC)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SH0510 (mvaC)
   00310 Lysine degradation
    SH0510 (mvaC)
   00380 Tryptophan metabolism
    SH0510 (mvaC)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SH0510 (mvaC)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SH0510 (mvaC)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SH0510 (mvaC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sha04147]
    SH0510 (mvaC)
Enzymes [BR:sha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SH0510 (mvaC)
Exosome [BR:sha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SH0510 (mvaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAE03819
NITE: SH0510
UniProt: Q4L956
Position
524389..525540
Genome map
AA seq 383 aa AA seqDB search
MKKIAIVSAKRTPIGRYKGKLRNYSAVELGTTALKGAIDSANIDPNIIQQVIFGNVLQSG
VGQNPARQIAIKAGVPDTTPAMTINEVCGSGLKAIILGKQLIQLGEADVVAVGGVESMTN
APQLILKEGQEPVESFMHDGLTDAFHYVPMGVTAENIAEKYDITREMQDEFANHSQAKAA
KATQDGKFNNEIIGMTDAEGEQMTSDEGVRPNSSVEKLATLKTIFKEDGTVTGGNASSIN
DGSSALILMEESYAKAHGYDILGIVGDYAEVGCDPQYMGYAPFYAVEKLLDKTDSKIDDV
DIVEMTEAFAAQSIPVKDNLHIPDEKLNIYGGAIALGHPIGASGARLVTTLVNALEQENK
RTGIATACIGGGLGIALMIDKGE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgctatagttagtgctaaaagaacgccaatcggtagatataaaggtaaa
ttaagaaattattctgcagttgaattgggaacgacagctttgaaaggtgcaatcgattca
gcaaatattgatcctaatataatacaacaagttattttcggtaatgtgctacaaagtggt
gtaggacaaaacccagcacgtcaaattgcgattaaagcgggtgtacctgatacaacacca
gctatgacaattaatgaggtatgtggatcaggtcttaaagcaattatattagggaaacag
ttaattcaattaggtgaagcggatgtagtagcagtgggtggagttgaaagtatgacaaat
gccccacaattaatcttaaaagaaggtcaagaaccagtggaaagttttatgcatgatggt
ttaacagatgcctttcattatgtaccaatgggtgtaacagctgagaacatagctgaaaaa
tatgacatcacgcgtgaaatgcaagatgagttcgcaaatcattcacaagctaaagcagct
aaagcgacgcaagatggtaaatttaataatgaaatcatcggtatgactgacgcagaaggg
gaacaaatgacttctgatgaaggtgttcgcccaaatagtagtgttgagaagcttgcgaca
ttaaagacaattttcaaagaagatgggacagtaactggtggtaatgcttcaagtattaat
gatggttcatctgcactcattttaatggaagaatcatatgctaaagcgcatggttacgat
attttaggaattgttggagattatgcagaagtaggttgtgacccacaatatatgggctat
gcgccattctatgctgttgagaagctacttgataaaacggatagcaaaatcgatgacgtt
gatattgtagaaatgactgaagcatttgctgcacaaagtataccagtcaaagacaatttg
catattccagatgaaaaattaaatatctatggcggtgctattgcactaggacacccaatt
ggtgccagtggtgctagattagtcactactttagtgaacgcacttgaacaagaaaataaa
cgtacgggtattgctacagcatgtattggtggaggactaggtatcgctctaatgattgat
aaaggggaataa

DBGET integrated database retrieval system