KEGG   Staphylococcus haemolyticus JCSC1435: SH1214Help
Entry
SH1214            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; acetate kinase homolog
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00430  Taurine and hypotaurine metabolism
sha00620  Pyruvate metabolism
sha00640  Propanoate metabolism
sha00680  Methane metabolism
sha01100  Metabolic pathways
sha01120  Microbial metabolism in diverse environments
sha01200  Carbon metabolism
Module
sha_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SH1214
   00640 Propanoate metabolism
    SH1214
  09102 Energy metabolism
   00680 Methane metabolism
    SH1214
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SH1214
Enzymes [BR:sha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SH1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: BAE04523
NITE: SH1214
UniProt: Q4L752
Position
1243304..1244500
Genome map
AA seq 398 aa AA seqDB search
MSSLVLAINAGSSSLKFQLIRMPEETLVTKGLIERIGIKDSIFTIEVNGEKIKDVKDIKD
HEEAINIMLDSFKQHGIIDDINDIAGTGHRVVHGGELFPTSALVTDKVEEQIESLSELAP
LHNPANLMGIRAFRKLLPNIPHVAVFDTSFHQSMPEQSYLYSLPYQYYKDYGIRKYGFHG
TSHKYVSQRAAEIMNKPIEELRIISCHIGNGASIAAIDGGESIDTSMGFTPLAGVTMGTR
SGNIDPALIPFIMQKTGQNAEEVLNVLNKESGLLGISGTSSDLRDLESDAEEGKERAQLA
LDVFASRIHKYIGSYATRMHGVDVIVFTAGVGENSSTVRAKVLEGLEFMGIYWDPKKNET
IRGEEGFINYPHSPVKVIVIPTNEEVMIARDTVKFGEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtttagttttagcgattaacgctggtagttcttctttaaaattccaactaata
agaatgcctgaagaaactctagtaacaaaaggtttaatcgaacgtatcggtattaaagat
tcaatcttcacaattgaagtgaatggtgaaaaaattaaagatgttaaagatatcaaggat
catgaagaagctattaacatcatgttagacagtttcaaacaacatggcatcattgatgac
attaatgatattgctggtacaggacatcgtgtcgtgcacggtggtgagttattcccaacg
tctgcattagttacagataaagtggaagaacaaattgaatcattaagtgaattagcacca
ttgcataaccctgctaacttaatgggtatccgtgcattcagaaaattattaccaaacatt
cctcatgtagcagtgtttgatacttcattccaccaatcaatgccagaacaatcatattta
tatagcttaccttaccaatactataaagattatggcattcgtaaatatggtttccacggt
acaagtcacaaatatgtatcacaacgtgctgctgaaatcatgaataaaccaattgaagag
ttacgcattatctcttgtcatattggtaatggtgcatcaattgctgccatcgatggtggt
gaatcaatcgatacatcaatggggttcactccattagcgggtgtaacaatgggtacacgt
tcaggtaatatcgaccctgcattaattccattcattatgcaaaagactggtcaaaacgcc
gaagaagttcttaatgtattaaacaaagaatcaggtctacttggtatttcaggtacatca
agtgacttacgtgaccttgaaagtgatgcagaagaaggaaaagaacgtgcacaattagca
ctagacgtatttgcttcaagaattcataaatatattggttcttatgctacaagaatgcat
ggcgtggatgtcattgtatttacagctggtgtaggagaaaactcttcaacagttcgtgct
aaagtattagaaggcttagaattcatgggcatctattgggatcctaagaaaaatgaaaca
atccgtggtgaagaaggatttatcaattacccacactcaccagttaaagttattgttatt
ccaacaaatgaagaagttatgattgctagagatacagttaaatttggcgaattataa

DBGET integrated database retrieval system