KEGG   Staphylococcus haemolyticus JCSC1435: SH1411Help
Entry
SH1411            CDS       T00250                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00030  Pentose phosphate pathway
sha00480  Glutathione metabolism
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
sha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SH1411
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SH1411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sha04147]
    SH1411
Enzymes [BR:sha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SH1411
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SH1411
Exosome [BR:sha04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SH1411
  Exosomal proteins of colorectal cancer cells
   SH1411
  Exosomal proteins of bladder cancer cells
   SH1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAE04720
NITE: SH1411
UniProt: Q4L6K5
Position
complement(1439210..1440694)
Genome map
AA seq 494 aa AA seqDB search
MSKHSKHIPCLITIFGATGDLSHRKLFPSLFHLFQQDNLDEHIAIIGIGRRDYTNEVFRE
QVKSSIQKHVKDTDQIDAFMEHVYYFKHDVSDEQSYDSLLSFSNELDSQYQLKGNRLFYL
AMAPQFFGIISDYLKSSGLTDTTGFKRLVIEKPFGSDLKSAEQLNNQLRRSFKEEEIYRI
DHYLGKDMVQNIEVLRFSNAMFEPLWNNKYISNIQVTSSEVLGVEDRGGYYESSGALKDM
VQNHMLQMVALLAMEAPISLNSEDIRAEKVKVLKSLRQLDPQEVKQNFVRGQYDEGFVEG
EKVIAYRDEDRVAEDSNTPTFVSGRLTIDNFRWAGVPFYIRTGKRMKSKSIQVVVEFKEV
PMNLYYQTDKLLDSNLLVINIQPNEGISLHLNAKKNIQGIDTEPVQLSYAMSAQDKMNTV
DAYENLLFDCLKGDATNFTHWEELKSTWKFVDVIQDEWTMNEPNFPNYESGTNGPLESDL
LLSRDGNHWWDDIQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaacattctaaacatattccttgtttaattactattttcggtgctaccggagat
ttaagtcatagaaaattatttccatcactattccacttatttcaacaagataatttagat
gaacatattgcaataattggaattggacgtagagattacacgaacgaagtctttcgtgaa
caagttaaaagttctatccaaaagcatgtcaaagatacggatcaaattgatgcatttatg
gaacatgtctattattttaaacatgatgtaagtgatgaacaaagttatgattcattattg
agtttttcaaatgaattagattcacaatatcagttaaaaggaaatcgcttgttttattta
gcaatggcacctcaattctttggtattatttcggattacttaaaatcatctggtttaacc
gatactactggttttaaacgattagttattgaaaaaccatttggcagtgatttaaaatcg
gctgagcaattaaacaatcaattaagacgctcatttaaagaagaagaaatatacagaatt
gatcattatttaggtaaagatatggttcaaaatatagaagtcttgcgcttttcaaatgcg
atgtttgaaccattatggaataataaatacatttcaaacattcaagtaacgtcttcagaa
gtattaggtgttgaggaccgtggaggttattatgaatctagtggcgcattaaaagatatg
gtacaaaatcatatgttacaaatggttgcccttttagctatggaagcgccaatcagctta
aatagtgaagatatacgtgctgagaaagttaaagtattgaaatcacttagacagcttgat
cctcaagaagtaaaacaaaattttgtacgtggacagtatgatgaaggatttgttgaaggt
gaaaaagtcattgcttatcgagatgaagatcgagtagccgaagattcaaatactccaact
tttgtatcaggccgactaacaattgataacttccgttgggctggcgtacctttttatatt
agaacgggaaaacgtatgaaatctaaatcgattcaagttgtagttgagttcaaagaagta
ccaatgaacttatactatcagaccgataaattgttggattcaaacttattagttattaat
attcaacccaatgagggtatatcacttcatttaaacgcgaaaaagaacatccaaggtatt
gatacagaacccgttcaattatcatatgcaatgagtgctcaagataagatgaacactgtt
gatgcctatgaaaatttactattcgattgtttaaaaggtgatgctacaaactttacacat
tgggaagaattaaaatctacatggaagtttgttgatgttatacaagatgaatggacaatg
aatgaacctaacttccctaactatgagtcaggtacaaatggaccattagaaagtgattta
ctattaagtagagatggtaatcattggtgggatgatattcagtaa

DBGET integrated database retrieval system