KEGG   Staphylococcus haemolyticus JCSC1435: SH1493Help
Entry
SH1493            CDS       T00250                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00020  Citrate cycle (TCA cycle)
sha00310  Lysine degradation
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
sha01200  Carbon metabolism
Module
sha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SH1493 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SH1493 (odhB)
Enzymes [BR:sha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SH1493 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: BAE04802
NITE: SH1493
UniProt: Q4L6C3
Position
1534087..1535358
Genome map
AA seq 423 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEEGVLQEQLA
SEGDTVEVGQVIATVGEGSGNASSSKEESSDQSQSANNDEATKELAQPTESQSNNEETQS
NPNNQRVNATPSARRHARENGVDLSTVSGKGNDVVRKDDVENSQKAAQSQSSQETSKKEE
PKKSSGAPNKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQF
IKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF
VRDCDKKNFAELERAIADLAVKARDKKLGLDDMVNGSFTITNGGVFGSMMSTPIINGNQA
AILGMHSIITRPIAIDKDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIESPEDLL
LES
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtaaaagttccagaattagcagaatctataacagagggtaccattgcagaa
tggttaaaaaatgtgggagatagcgttgaaaaaggcgaagctatcctagaattagagaca
gataaagtaaacgttgaagttgtttctgaagaagaaggtgtacttcaagaacaattggct
tctgaaggcgacactgtggaagttggccaagttatcgcaactgttggcgaaggtagtggt
aatgcttcttcaagcaaagaagaatcttcagaccaatctcaatctgcgaacaatgacgaa
gcgactaaagaattagctcaaccaacagaatctcaatcaaataatgaagaaacgcaatct
aatcctaacaatcaacgtgttaatgcaaccccatcagctcgtcgccatgcacgtgaaaac
ggtgtagatttaagcactgtttctggaaaaggaaacgatgttgtacgtaaagatgatgtt
gaaaatagtcaaaaagcagctcaatctcaatcttctcaagaaacaagcaaaaaagaagaa
cctaaaaaatcttcaggtgcacctaataaacctgtaattagagaaaaaatgtctcgtaga
aagaaaacagctgctaaaaaattattagaagtttctaataatacagcaatgttaactaca
ttcaatgaagtagatatgacaaacgtaatggaattacgtaaacgtaagaaagaacaattt
attaaagatcatgatggaactaaattaggtttcatgtcattctttactaaagctgctgta
gctgcattgaaaaaatatccggaagtaaacgctgaaattgacggcgatgacatgattact
aaacaatattatgacatcggtgttgcggtttctactgatgatggattattagttcctttc
gtaagagattgtgacaagaaaaactttgcagaacttgaaagagctattgctgacttagca
gttaaagcaagagataaaaaacttggtttagatgatatggttaatggatcatttacaatt
actaatggtggtgtatttggttcaatgatgagtactccaattattaatggtaaccaagca
gctattcttggtatgcactcaatcattacccgtccaattgcaattgataaagatacaatt
gagaatagaccaatgatgtatattgctttaagttatgaccatagaattattgatggtaaa
gaagcagtaggattcttaaaaacgattaaagaattaatcgaaagccctgaagatttactt
ttagaaagctaa

DBGET integrated database retrieval system