KEGG   Staphylococcus haemolyticus JCSC1435: SH1539Help
Entry
SH1539            CDS       T00250                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01130  Biosynthesis of antibiotics
sha01230  Biosynthesis of amino acids
Module
sha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SH1539 (trpC)
Enzymes [BR:sha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SH1539 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE HSDR_N_2 BBE Polysacc_deac_2
Motif
Other DBs
NCBI-ProteinID: BAE04848
NITE: SH1539
UniProt: Q4L677
Position
complement(1579202..1579984)
Genome map
AA seq 260 aa AA seqDB search
MTILSEIVDYKEQLLKDGYYHDKLQNLKGVKHKNKSRLTDALIKNDNLTLIAEIKSKSPS
VKAFQQTNIIKQVSDYERYGANAISVLTDERYFGGSFERLQQISETTQLPVLCKDFIIDP
LQIDVAQKAGASIILLIVNILTDEKLRQLYQYASSKGLEVLVEVHDGIELQRAYQLNPQI
IGVNNRDLKSFNTDVKHTNQILKCKKENYLYISESGIHSQQEVKQIVKSGIDGLLVGGAL
MNCNELEHFIPSLKLKKVKQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatattaagtgaaatagtggattataaagagcaattattaaaagacggctattat
catgataaattacaaaatttgaaaggggtaaaacataaaaataaatcgcgattaacggat
gctttaattaaaaatgacaatttaacattaattgctgaaattaaatcaaagagtccatct
gtaaaagcttttcaacaaacaaatataattaaacaagtgagtgattatgaacgttatgga
gcaaatgctatctccgtattaacagacgaacgatatttcggtggtagctttgaaagatta
cagcaaatatcagaaacaacacaattacctgttttatgtaaagatttcatcattgatccg
cttcaaattgatgttgcacaaaaagcaggtgcttcaattattttactcattgtaaatatt
cttaccgacgaaaagttacgacaactctatcaatatgcaagttctaagggactagaagtg
ttagtagaggtacatgatggtattgagttacaacgtgcctatcagttaaatccacaaatc
attggggtaaacaatcgtgatttaaaatcattcaacaccgatgttaaacatactaatcaa
atacttaagtgtaagaaagagaactatttatatatttctgaaagtggaattcattcacaa
caagaggttaagcaaatagtaaaaagcgggatcgatggtttattagttggtggagcctta
atgaattgtaatgagttagaacattttataccctcacttaaattaaaaaaggtgaaacaa
tga

DBGET integrated database retrieval system