KEGG   Staphylococcus haemolyticus JCSC1435: SH2210Help
Entry
SH2210            CDS       T00250                                 

Gene name
bacA
Definition
(GenBank) bacitracin resistance protein homologue
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SH2210 (bacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sha01011]
    SH2210 (bacA)
Enzymes [BR:sha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     SH2210 (bacA)
Peptidoglycan biosynthesis and degradation proteins [BR:sha01011]
 Precursor biosynthesis
  Diphosphatase
   SH2210 (bacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-ProteinID: BAE05519
NITE: SH2210
UniProt: Q4L4A6
Position
2247250..2248125
Genome map
AA seq 291 aa AA seqDB search
MIIIEFIKGLILGIVEGLTEFAPVSSTGHMILVDDMWLKSTEFLGPHSAFTFKVVIQLGS
VFAAAWVFRERYFEMLHIGKYRNSSINEEFRSKPRRLNLLHVLVGMIPAGILGVLFDDFI
EAHLFSVPTVMIGLFLGAIYMIIADKYSKKVQNPKSVDQINYVQAFVIGISQAVAMWPGF
SRSGSTISTGVLMKLDHKSASDFTFIMAVPIMLAASALSLVKNYQYIELAHIPFYLIGFL
AAFIVGLIAIKTFLHLINKVKLVPFAIYRIVLVIIIAILYFGFGIGQGISG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattattatcgagtttataaagggccttatcttaggtattgtcgaaggtttaactgaa
tttgctccagtttcatctacaggtcatatgattctagtggatgatatgtggttaaaatcg
actgaatttctaggtcctcattcagcttttacatttaaagtcgtaattcaattaggttct
gtttttgctgcggcatgggtgttccgtgagcgttatttcgaaatgttacatattggcaaa
tatagaaatagttcaataaacgaggagtttcgttctaaaccacgtcgattaaatttacta
cacgtattagtcggtatgattccagctggtatattaggtgtgttattcgacgattttatt
gaagcgcatttatttagtgttcctactgtaatgattggtttattcttaggtgcaatttat
atgattattgcagacaaatatagtaaaaaagttcaaaaccctaagtcagttgaccaaatc
aattatgttcaagcattcgtaattggtatctctcaagcggtagcaatgtggcctggtttc
agtagatctgggtctacgatctcaacaggtgtcttgatgaagttagatcataagtctgct
tctgactttaccttcattatggctgtacctattatgctagctgcaagtgcactatcatta
gttaaaaactatcaatatattgaacttgcacatattccattttacttaattggattcttg
gctgcctttattgttggcttgattgcaatcaaaacattcttacacttaattaataaagtt
aagttagtaccatttgcaatttatcgaatcgtattggtaataattatagccattctttac
ttcggctttggaattggtcaaggcatttcaggttaa

DBGET integrated database retrieval system