KEGG   Staphylococcus haemolyticus JCSC1435: SH2417Help
Entry
SH2417            CDS       T00250                                 

Definition
(GenBank) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00071  Fatty acid degradation
sha00072  Synthesis and degradation of ketone bodies
sha00280  Valine, leucine and isoleucine degradation
sha00310  Lysine degradation
sha00362  Benzoate degradation
sha00380  Tryptophan metabolism
sha00620  Pyruvate metabolism
sha00630  Glyoxylate and dicarboxylate metabolism
sha00640  Propanoate metabolism
sha00650  Butanoate metabolism
sha00900  Terpenoid backbone biosynthesis
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
sha01200  Carbon metabolism
sha01212  Fatty acid metabolism
sha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SH2417
   00630 Glyoxylate and dicarboxylate metabolism
    SH2417
   00640 Propanoate metabolism
    SH2417
   00650 Butanoate metabolism
    SH2417
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SH2417
   00072 Synthesis and degradation of ketone bodies
    SH2417
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SH2417
   00310 Lysine degradation
    SH2417
   00380 Tryptophan metabolism
    SH2417
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SH2417
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SH2417
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SH2417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sha04147]
    SH2417
Enzymes [BR:sha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SH2417
Exosome [BR:sha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SH2417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAE05726
NITE: SH2417
UniProt: Q4L3Q1
Position
complement(2414219..2415364)
Genome map
AA seq 381 aa AA seqDB search
MKEAVVIWAKRTPFGKYGGALRHLEPEALLLPLFQNLKQTFPEVMDQVDDVVLGNVVGNG
GNVARKSLLEAGLNHRIPGITLDRQCGSGLESIIYACRMVQCEAGKVFIAGGVESTSRAP
WKIKRPQSVYEMQLPQFFERASFAPEGQDPSMIEAAENVAQHYNISRNDQDLFAARSHRL
VATHFNNGDINREIVPLTIKGALFDRDESLKPNLTEARLHRLRPILPNGTVTVGNSCMKN
DGAGIALIMEKEMAVAMGIKWGMLYRDAVTTGVDPTLLGIGPVPAVSQLLKRQKLNIEDI
SAIELNEAFSSQVLASINELHLGLDKVNQWGGAIATGHPYSASGAALVARLLNLPNWQYG
IATMGIGGGMGNAVLFEKWRQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagttgtaatatgggctaaaagaacaccgtttggtaaatatggtggtgcg
ttaagacatttagaacctgaagcgctgttgttaccactttttcaaaatttgaagcaaaca
tttcctgaagtaatggatcaagtggatgatgttgtattaggtaatgttgtagggaatggt
ggtaatgttgcgagaaagtcgttactagaagccggtttaaatcatcgaattcctggcata
acattagaccgtcaatgtggctcgggtttagaaagtatcatttatgcgtgtcgaatggtg
caatgtgaggctgggaaggtgttcattgctggtggcgtagagagtacaagtcgtgcacca
tggaagattaagcgtcctcaatctgtctatgaaatgcaattaccacaattttttgagcgt
gcatcatttgcacctgaaggtcaagatccaagcatgatagaagcagctgagaatgtcgca
caacattataatatatctcgtaatgatcaagacttatttgcagcacgtagtcatcggtta
gtggcaacgcattttaataatggtgatattaaccgtgagattgttcctcttacaattaaa
ggagcgttgtttgatagggatgaaagtttaaagccaaatctgactgaggcgcgtttacat
agattacgtccaatattaccaaatggtacagttacagttggtaatagttgcatgaagaat
gatggtgccggaatagctttaataatggaaaaggaaatggctgtggcaatggggattaaa
tggggaatgttatatagagatgctgttacaacaggtgtggatccaaccttattagggata
ggtccagtacccgcagtttctcaattattgaaaaggcagaaattaaatattgaagatata
tcagccattgaactgaacgaagcatttagttctcaagtgctggcatctataaatgagttg
catttaggtttggacaaggtaaatcaatggggaggtgcgattgctactggacatccatat
agtgctagtggcgcggcattagttgctagattattaaacttacctaattggcaatatgga
attgctaccatgggtataggaggaggtatgggaaatgcggtactctttgaaaagtggcgc
caatga

DBGET integrated database retrieval system