KEGG   Staphylococcus haemolyticus JCSC1435: SH2436Help
Entry
SH2436            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; deoxyguanosine kinase homolog
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00230  Purine metabolism
sha00240  Pyrimidine metabolism
sha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SH2436
   00240 Pyrimidine metabolism
    SH2436
Enzymes [BR:sha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SH2436
    2.7.1.76  2'-deoxyadenosine kinase
     SH2436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_17 AAA_15 ABC_tran AAA_33 RsgA_GTPase Cytidylate_kin2 TsaE AAA_22 RNA_helicase MMR_HSR1 Cytidylate_kin NB-ARC AAA_14 AAA_16 AAA_29 AAA PRK PduV-EutP GTP_EFTU ATP_bind_1 AAA_25 NACHT NTPase_1 ParA AAA_5
Motif
Other DBs
NCBI-ProteinID: BAE05745
NITE: SH2436
UniProt: Q4L3N2
Position
2437464..2438126
Genome map
AA seq 220 aa AA seqDB search
MNNYKVPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVDHNPYLDKFYDDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFIQDRSIYEDVDIFAKMHEEQGTMNEDDFKTYSELFN
AMVMTPYFPKPDVLIYLECDYNEVIERIKARGRDMEINTDPEYWQKLFKRYEDWINNFNA
CPVVRVNINEYDIHENPDSLDPIIDKIAHVINTYRKVDNR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattataaagtacctcaaaacgcaataatcaccattgctggtaccgttggtgtt
gggaaatcaacattgacacaggctttagctgacaaattaaattttaaaacctcttttgaa
aatgtagatcataatccttatctagataaattttatgatgactttgaacgttggagtttc
cacttacaaatctactttttagcagaacgttttaaagaacaaaaacgtatgtttgaatat
ggtggtggattcattcaagatcgctctatttatgaagatgttgatattttcgcgaaaatg
cacgaagaacaaggtactatgaatgaagatgattttaaaacatattctgagttgttcaat
gcaatggtaatgacaccttacttccctaaacctgatgtattaatttatcttgagtgcgac
tacaatgaagtaattgagcgtatcaaagcacgtggtcgtgatatggaaattaatacggat
cctgagtattggcaaaagttattcaaacgttatgaagactggataaataactttaatgcc
tgtccggtcgtgcgcgttaacatcaacgaatatgatattcatgaaaacccagactcttta
gacccaattattgataaaattgctcatgtaattaatacttatcgcaaggtagataatcgt
taa

DBGET integrated database retrieval system