KEGG   Staphylococcus haemolyticus JCSC1435: SH2479Help
Entry
SH2479            CDS       T00250                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sha00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SH2479 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sha01007]
    SH2479 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sha03016]
    SH2479 (cysS)
Enzymes [BR:sha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     SH2479 (cysS)
Amino acid related enzymes [BR:sha01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SH2479 (cysS)
Transfer RNA biogenesis [BR:sha03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SH2479 (cysS)
 Prokaryotic type
    SH2479 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f DUF4238 VPS28 PP2C_C UVR tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: BAE05788
NITE: SH2479
UniProt: Q4L3I9
Position
complement(2478155..2479555)
Genome map
AA seq 466 aa AA seqDB search
MITLYNTLTRQKETFEPIEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYKGYE
VIYVSNFTDVDDKLINRSKELNESVPDIADRYIKAFYEDVGALNVKKATSNPRVMNHMDE
IIDFIKELVDEGYAYESDGDVYFRTRKFEGYGKLSHQSLDDLKVGARIEAGEQKEDALDF
TLWKKAKPGEISWESPFGEGRPGWHIECSVMAFHELGKTIDIHAGGSDLQFPHHENEIAQ
SEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSP
INYNLELVNAAKSGLERIRNSYQLIEERETIATDIVDQSKYIEQIDAIIEQFETVMDDDF
NTANAVTAWYDLSKLANKYVLENNTSTQVISRFKEVYQIFSDVLGVPLKGNKSDMLLDED
IEKLIEERNEARKNKDFARADEIRDMLKEQNIILEDTPQGVRFKRG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgattacattatataatacattaacgcgtcaaaaagagacatttgaacctatcgaacca
ggtaaggtgaaaatgtatgtctgtggtccgacagtatacaattatattcacattggtaat
gcacgccctgccataaattatgatgttgtacgtagatattttgaatataaaggatacgaa
gtgatttatgtttcaaacttcacagatgtagacgataaattaataaatcgttctaaggaa
ttgaatgagagtgtaccggatattgcagatagatacattaaagcgttttatgaagatgtt
ggtgcattaaacgttaagaaagcgacttcgaatccacgtgtaatgaatcatatggatgag
attattgattttattaaagagctagttgatgaaggttacgcctatgagagtgacggcgat
gtctactttagaacacgcaaatttgaaggttacggtaaattaagccatcagtcattagat
gatttaaaggtaggagcaagaatagaagctggggaacaaaaagaagatgcgttagacttt
actttatggaaaaaagcaaaaccaggtgaaattagttgggaaagtccttttggtgaaggg
cgtccaggttggcatattgaatgttcagtaatggcgtttcatgaactaggcaaaacaatt
gatattcatgctggtggttctgacttacaattccctcatcacgaaaacgaaattgcgcaa
tcagaagcgcataatcatgccccatttgctaattactggatgcataatggttttataaat
atagataacgagaaaatgagtaaatcgttaggtaactttatactagttcatgacatcata
aaagaagtagatcctgacgtactgcgattcttcatgattagcgtacattatagaagtcct
attaactataatctagaacttgttaatgcagctaagagtggtttagaacgcattcgtaat
agctatcaattaatagaagaacgtgaaacaatcgcgacagacatcgttgaccaatctaaa
tatatcgaacaaattgatgctattatagagcaatttgagacagtaatggatgatgatttc
aatactgctaatgctgttacggcttggtacgatttatctaaacttgcgaataaatatgtt
ttagagaacaatacatctactcaagtcatttctcgattcaaagaagtttatcagatattt
agtgatgtacttggagttccactaaaaggtaataaatcagatatgttacttgatgaagat
attgaaaagctcatcgaagaacgtaatgaagcgcgtaaaaataaagactttgcacgtgca
gatgaaataagagacatgcttaaagaacaaaacattatattagaggatacgccacaaggt
gtacgctttaaacgtggataa

DBGET integrated database retrieval system