KEGG   Sulfurospirillum halorespirans: SHALO_0213Help
Entry
SHALO_0213        CDS       T04475                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14261  alanine-synthesizing transaminase [EC:2.6.1.-]
Organism
shal  Sulfurospirillum halorespirans
Brite
KEGG Orthology (KO) [BR:shal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shal01007]
    SHALO_0213
Enzymes [BR:shal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     SHALO_0213
Amino acid related enzymes [BR:shal01007]
 Aminotransferase (transaminase)
  Class I
   SHALO_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOO64010
UniProt: A0A1D7TGE7
Position
213476..214687
Genome map
AA seq 403 aa AA seqDB search
MFDEIRFNTIDRLPGYVFAEINELKLAARHAGDDIIDFSMGNPDGRTPQHIIDKLVESAQ
KDGTHGYSVSKGIYKLRLAICNWYARKYGVTLDPNTEAVATLGSKEGFVHLAQAIMNPGD
VAVVPDPAYPIHAYAFMIAGGNVHKFSLDYDEKYVLDKEQFFTKLKKVFKESAPKPKFVV
VNFPHNPTCVTTDVSFYEELVAYAKEERFYIISDIAYADLSFDGYETPSIFQVEGAKDVA
VECYTLSKSYNMAGWRVGFVVGNKKLVGALQKIKSWFDYGMFTPIQVASTVALDGPQECV
DEIRATYQKRRDVLVESFNNAGWPMEKPQSTMFVWAKIPKVAAHLGSMEFAKQLLQEAKI
AVSPGIGFGESGDGYVRIALIENENRIRQAARNVKKYLKSLEG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgagattagatttaataccattgatagattaccagggtatgtttttgccgaa
attaatgaactaaagcttgctgcacgtcatgcgggggatgatattatcgacttttcgatg
ggcaatcctgatggaagaaccccacagcatattattgacaaactcgtagaatctgctcaa
aaagatggcacacatggctattcggtgagcaagggtatttataaattacgattggcaatt
tgcaattggtatgcacgcaaatacggtgttacacttgatcctaatactgaagcggttgca
accctaggaagtaaagagggttttgtgcatttagcccaagcgattatgaatccaggtgac
gtggctgttgtgcctgatcctgcgtatccgattcatgcgtatgcgtttatgattgctggt
ggaaatgttcataaatttagccttgattatgatgaaaaatatgtcttggataaagagcaa
ttttttacaaaactcaaaaaagtatttaaagaatcagctccaaaaccaaaatttgtcgtt
gtaaactttcctcataacccaacgtgtgtgaccaccgatgtctctttttacgaagagttg
gttgcgtatgctaaagaagagcgcttttacattatcagcgatattgcctatgcagatctc
tcctttgatggctacgagacaccttccattttccaagttgaaggtgctaaagatgtcgcg
gttgaatgttatacgctctctaaaagctacaatatggcaggctggcgtgtcggttttgtt
gtgggtaacaaaaaacttgtgggtgcgcttcaaaaaatcaaatcatggtttgactatggt
atgtttacaccgattcaagtcgcttctacggtagcactcgatggtccacaagagtgtgtg
gatgaaattcgcgctacgtatcaaaaacgtcgtgatgttttagtcgagagctttaacaat
gctggctggccgatggaaaaaccgcaatcaacgatgtttgtctgggcaaaaattcctaaa
gtggcagcacatttaggcagcatggagtttgcaaaacagttgcttcaagaggcaaaaatt
gctgtgagtcctggtattggttttggcgaaagtggcgatggttatgtgagaattgcgctc
atcgaaaatgagaacagaatccgccaagctgcacgtaatgtgaagaagtatttgaagagt
ttagaaggttaa

DBGET integrated database retrieval system