KEGG   Sulfurospirillum halorespirans: SHALO_0771Help
Entry
SHALO_0771        CDS       T04475                                 

Definition
(GenBank) polyribonucleotide nucleotidyltransferase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
shal  Sulfurospirillum halorespirans
Pathway
shal03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:shal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SHALO_0771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:shal03019]
    SHALO_0771
   03016 Transfer RNA biogenesis [BR:shal03016]
    SHALO_0771
Enzymes [BR:shal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     SHALO_0771
Messenger RNA biogenesis [BR:shal03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SHALO_0771
Transfer RNA biogenesis [BR:shal03016]
 Prokaryotic type
  tRNA degradation factors
   SHALO_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C S1 PNPase KH_1 Acatn DUF445
Motif
Other DBs
NCBI-ProteinID: AOO64554
UniProt: A0A1D7TI64
Position
772848..775091
Genome map
AA seq 747 aa AA seqDB search
MEYKIRVNNQEEIYDLGKVAKQAAGAALLKIKNTVILATVARDDSQVGENFVPLTVQYVE
KTYAVGKIPGGYFKRETKPGDFETLTSRIIDRSLRPLFPKGYAYPTQIVIFVLSCDPEVD
LQVAALNAASAALYLSDIPVNKAVAGVRIGYIDGQYVVNPSNSALKTSTLDLYVAGTKEE
LLMIEMRSLASMESMSLPIMAIDPMLDPTLAQNVIVKQSVNEFDEDAIVAAIDKAQSAIT
EATTAYENTFKPLKKEDAVLDYKQDLANDSIFAYVDEFYKDEVNNAINQMAKSERASELG
KIVTKILGDEVAVLEGWSKELVDSVVQAYKKKIVREMIIEKRVRADGRKLNEIRPISIET
NLLPLAHGSCLFTRGQTQALAVVTLGNDKDAQMYDLLTEKNTINDTFMVNYNFPGFSVGE
ASPLRAPGRRELGHGNLARRALEPVLDRNRLQTIRLVSEILESNGSSSMATICGGALALK
AAGVNLEKLVAGIAMGLVFEGDKHAVLSDIMGLEDHDGDMDFKVAGTREGITALQMDIKL
GGISRDVLKEALYQAKEGRAHILGLMEAASEEIVINNAILPKLELFSVDPSKIVDIIGQA
GKTIREIIERFEVSIDLDREKGEVKIAGENKEKVEAAKEHIIQITNKPSFGGRGGGRDRG
GDRHSSPREEKPVPTFVQDEVVDGVVKRIVDFGAFIELPGGIDGLLHVSKIADHRVDKVS
DYLALEQKVRVKILKQTGNKIELGLER
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
gtggaatataaaattagagtgaataaccaagaagagatttacgatcttggcaaagttgca
aaacaagcagcaggggctgcattattaaagattaaaaatacggttattttagcaacggtt
gcgcgagatgattcccaagttggtgaaaattttgtaccgttaaccgtgcaatatgttgaa
aaaacctatgcggttggaaaaattcctggaggctattttaaacgtgagacaaagccaggt
gattttgaaacattaacctcacgtattattgatagaagccttcgcccactttttcctaaa
gggtatgcttatccaacacaaattgttattttcgtcttaagctgtgatcctgaagttgat
cttcaagtagcagcgcttaacgctgcgagtgcggcactttatctttccgatattcctgtg
aataaagccgttgcaggtgtgcgtattggttacattgatgggcagtatgttgtgaatcct
tccaactcagctctaaaaacaagcacgttggatctgtatgttgctggaacaaaagaagag
ctcttaatgatcgagatgcgctccctcgcttccatggagagtatgagccttcctattatg
gcaattgacccaatgcttgatcctacccttgcacagaacgttattgtgaagcaatccgtt
aatgaatttgatgaagatgcgattgttgccgcaatcgataaagcgcaaagtgcaattact
gaagcgacaacggcgtatgaaaatacctttaaacctcttaaaaaagaggatgctgtactt
gattataaacaagatttagcgaatgattctatttttgcgtacgtggatgaattctacaaa
gacgaggttaacaacgcgatcaaccaaatggcaaaaagtgagcgtgcgagtgagcttgga
aaaattgttactaaaattttaggtgatgaagtagcggtcttggagggctggagcaaagag
ttagtggacagcgttgtgcaagcgtataaaaagaaaatcgtgcgagagatgattattgaa
aaacgtgtgcgtgctgatggtagaaagctcaatgaaatcagaccgattagcatcgaaacc
aatcttttacctttagcgcatggttcatgcctctttacccgtggtcagacacaagcactt
gcagttgtcacactgggaaatgataaagatgcgcaaatgtatgatcttttgacggaaaaa
aatacgattaacgatacctttatggtgaactataacttcccaggtttctccgtaggtgaa
gcttctccgcttcgcgctcctggtcgaagagagttgggtcatggcaatcttgcacgtcgt
gcacttgaacctgttcttgatagaaatcgtttgcaaaccattcgtttagtatcagagatt
ttagaatccaacggctcctcttctatggcaaccatttgcggtggcgcattagcgctgaag
gctgctggagtcaatcttgaaaaactcgtagcgggtattgctatgggacttgtttttgag
ggcgataaacatgcggttctcagtgacatcatgggcttagaagatcacgatggtgatatg
gactttaaagtcgctggaacaagagaaggcattacagcacttcaaatggatattaaattg
ggcggcatttcacgtgatgtccttaaagaagcattgtatcaagccaaagagggtagagcg
catattttaggcttgatggaagcggcaagtgaagagattgtgattaacaatgccattttg
ccaaaactggaactctttagtgtcgatccttccaaaattgtggatattattggacaagcg
ggtaaaacgattcgtgagattattgagcgatttgaagtctctatcgatcttgatcgtgaa
aaaggcgaagtgaagatcgcaggcgagaacaaagaaaaagtagaagcggctaaagagcat
atcatccaaattaccaataagccttcttttggcggacgtggtggtggaagagatagagga
ggagatcgtcatagttctccaagagaagaaaaaccagtgccaactttcgtgcaagatgaa
gtagttgatggtgtggtgaaacgcattgttgattttggtgcgtttattgaacttcctggt
gggattgatggattgttacatgtatccaaaattgccgatcaccgtgtggataaagtaagc
gattatttagcccttgagcaaaaagttcgcgttaaaatcttaaagcaaacaggaaataaa
atcgagcttggcttggagcgataa

DBGET integrated database retrieval system