KEGG   Sulfurospirillum halorespirans: SHALO_0878Help
Entry
SHALO_0878        CDS       T04475                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
shal  Sulfurospirillum halorespirans
Pathway
shal00450  Selenocompound metabolism
shal00970  Aminoacyl-tRNA biosynthesis
shal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SHALO_0878
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SHALO_0878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shal01007]
    SHALO_0878
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:shal03016]
    SHALO_0878
Enzymes [BR:shal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SHALO_0878
Amino acid related enzymes [BR:shal01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SHALO_0878
Transfer RNA biogenesis [BR:shal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SHALO_0878
 Prokaryotic type
   Other AARSs
    SHALO_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Zn-ribbon_8 DUF2072
Motif
Other DBs
NCBI-ProteinID: AOO64659
UniProt: A0A1D7TI26
Position
complement(890517..892454)
Genome map
AA seq 645 aa AA seqDB search
MSQKAYITTPIYYVNDVPHIGHAYTTIIADTMARYYRLKGYETFFLTGTDEHGQKIEEAA
KLRNKTPQAYADEISGKFRALWDEFEISYDKFIRTTDAEHKTGVQKAFQVMFDKGDIYKG
EYEGHYCVSCETFFTDTQLVDEDKCPDCGKLTRLVKEESYFFKLSKYQEDLIKWYNNDEK
CVLPRGKKNEVISFVKQGLRDLSITRTSFDWGVKLPASMNDDKHVMYVWLDALLNYTTAL
GYGTDEKNMDFWPATMHLVGKDILRFHAIYWPAFLMSLGLALPKHVAAHGWWTRNGEKMS
KSKGNVVNPKEVADAYGLENFRYFMLREVPFGQDGDFSQKALMDRINSDLGNELGNLLNR
IIGMSGKYSNGVINSKDVTTFHESELVAVDEILKTVENNLLELQTNRYLEELWKVLSIAN
QAITVHEPWVKIKEGKTEQALALVALVSNILARVSILLHPVMPKTTMTIAKAMGFEINTA
NYDKIVLRKTFLDEFTIEKVPPLFPRIEEELMEQPVESAPIVAPQPAKKEKKEAKIESII
TIDQFFETALKVGTILEASILEGSDRLLKLKVDLGEAEPRQIVAGIREYYTPEELINTQV
CVVANLKPATIKGLLSQGMLLAAKDKEGLCLVRPERPRQSGASIG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaaagcctacattaccaccccaatctactatgttaacgatgttccgcatatc
ggacatgcgtacacgaccattatcgcagacaccatggcacgctattatcgtttgaaaggc
tatgagacttttttcttaacaggaaccgatgaacacggtcaaaagatcgaagaagcggca
aaattacgcaacaaaacgcctcaagcctatgcggatgagatcagtggcaaattccgcgct
ctttgggatgagtttgagatcagttacgacaaattcatccgcacgacggacgccgagcat
aaaacgggggttcaaaaagcgtttcaagtcatgtttgacaaaggcgacatttacaaaggc
gaatacgaaggtcactactgtgtgagctgtgagactttttttacggacacccaactggtc
gatgaggacaaatgccccgattgtggcaaactcacccgtctggtcaaagaagagagttac
ttctttaaactctctaaataccaagaagatctcatcaaatggtacaacaacgatgagaaa
tgtgtccttccacgaggcaaaaaaaacgaagtgattagctttgtcaaacaaggacttcgt
gatctctctattacacgtaccagttttgactggggtgtgaaattgcccgcttcaatgaac
gatgataaacacgtcatgtatgtctggttggacgcccttttaaactacacaaccgcactt
ggatacggcaccgatgaaaaaaacatggacttttggcccgcaacgatgcacttagtgggc
aaagacattcttcgctttcatgccatctactggccagcatttttgatgagccttggtttg
gcgcttccaaaacatgtcgccgcacacggttggtggacgagaaatggtgagaagatgagc
aaaagtaaaggcaatgtcgttaatcctaaagaggttgccgatgcctatggcttagagaac
tttagatactttatgcttcgtgaagtgccgtttggtcaagacggtgactttagccaaaaa
gccttgatggatcgtatcaactccgatctgggcaatgagcttgggaacctactgaatcgt
atcatcggaatgagtggcaaatacagcaatggcgtgattaactccaaggatgtcacgacc
tttcatgagagtgagctggtggcggtggatgagatcttaaaaactgtcgaaaacaacctc
ttagagcttcaaaccaaccgttaccttgaagagctttggaaagtgctgagcatcgccaac
caagcgattaccgtgcatgagccgtgggtcaaaatcaaagagggaaaaacagagcaagcc
ttagcactcgtcgccctcgtttccaacatcttggcgcgtgtttccatacttttgcaccct
gttatgcctaaaacaactatgacgatcgccaaagcgatgggctttgagatcaacactgca
aactatgacaaaatcgttttgcgtaaaacctttttagatgaatttacgatcgaaaaagtg
ccaccacttttcccacgcatcgaagaggagttgatggaacaacctgttgaatctgcaccc
atagtcgcaccacaacctgctaaaaaagagaagaaagaggcaaagatcgagtcgatcatt
acgattgaccaattttttgaaaccgctttgaaagtgggaacgattttagaagcgagcatt
ttagaaggaagcgatcgtcttttgaaactcaaagtcgatctgggtgaagcagagccacga
caaattgtcgcagggattcgtgagtattacacgcctgaagagcttatcaacacccaagtg
tgcgtggttgcgaacctcaaacctgccacgatcaaagggctactcagccaaggtatgctc
ctagcagcaaaagacaaagagggactctgtttggttcgcccagaacgtcctcgccaaagt
ggcgcttcaattggatga

DBGET integrated database retrieval system