KEGG   Sulfurospirillum halorespirans: SHALO_1206Help
Entry
SHALO_1206        CDS       T04475                                 

Definition
(GenBank) lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
shal  Sulfurospirillum halorespirans
Pathway
shal00620  Pyruvate metabolism
shal00630  Glyoxylate and dicarboxylate metabolism
shal01100  Metabolic pathways
shal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SHALO_1206
   00630 Glyoxylate and dicarboxylate metabolism
    SHALO_1206
Enzymes [BR:shal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     SHALO_1206
    1.2.1.22  lactaldehyde dehydrogenase
     SHALO_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AOO64984
UniProt: A0A1D7TJD5
Position
1232746..1234194
Genome map
AA seq 482 aa AA seqDB search
MAETKVYQMYINGAFIASKETIPVMNPSTKEVISYIPKGSASDVDAAVESAQIAQHSWEK
LPAIERAGYLKKIAQKIRDNAEMLARTITEEQGKVLGLATVEVNFTADYIDYMAEWARRY
EGEIIQSDRPNENIFLFKLPIGVAAGILPWNFPFFLIARKLAPALITGNTIVIKPSSDTP
NNAFEFAKLVDQIGLPKGVFNLVSGSGSLVGHALAGHEKVGIVSFTGSVDAGVKIMEAAA
KNVTKVSLELGGKAPAIVMGDADINLAVEAIKNSRVINNGQVCNCAERVYVHKSIAQEFS
EKITKAMAATTYGNPLTEKADMGPLINEAAITHVQALVDSAIKAGAKLTTGGKRASRSDG
FYYEPTVLVDVKQEMGVIQEEIFGPVLPIMSFDTLDEVIGLANDCQYGLTSSIYTQNLDV
AMRACKEIKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLEEFLQTKVVYLQYNLN
KQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacgaaagtctatcagatgtatatcaatggtgcgtttatcgcttccaaagag
acgattcccgttatgaatccttcgaccaaagaggtgatttcgtatattccaaaaggcagc
gcaagcgatgttgatgcggccgtggaatctgctcaaattgcacagcactcatgggaaaaa
ctccctgcgattgagcgtgctgggtatttgaaaaagattgcgcaaaagattagagacaat
gctgaaatgctcgctcgaacgatcacggaagagcagggcaaagtcttaggacttgcaacg
gttgaggtgaattttacagccgattatattgattatatggctgagtgggcgaggcggtat
gagggtgagatcatccaaagtgatcgtcctaatgaaaacatctttttattcaaacttccc
atcggtgtggcagcaggcattttgccgtggaactttccgttctttttgatcgcacgtaaa
ctcgctcccgcactcattacgggcaatacgattgtcatcaaacccagttctgatacgccc
aataatgcgtttgaatttgcaaaattggtcgatcaaatcggacttcctaaaggcgttttt
aaccttgtttcgggttctggctcactagtcgggcatgcacttgcagggcatgaaaaagtg
ggcatcgtgagcttcacaggcagtgtggacgcgggtgtgaaaatcatggaagccgcggcc
aaaaatgtcacgaaagtttcgttagaactcggtggaaaagcgcctgcgattgtgatgggc
gatgcggacatcaatttagcggtggaagcgatcaaaaactcgcgcgtcattaacaacgga
caagtctgcaactgcgctgagcgggtttatgtgcataaaagcattgcgcaagagttttcc
gaaaaaattaccaaagcgatggcggcaacgacctatggcaatcctttaaccgagaaagcc
gatatgggaccgcttatcaatgaagcagccattacgcatgtgcaagcgttggtggatagt
gccatcaaagcaggggcaaagctcacgacgggtggtaaacgcgcctctcgcagtgatggt
ttctactacgaaccaacggttttggtcgatgttaaacaagagatgggtgtgattcaagag
gagatttttgggcctgtgcttccgattatgagctttgatacactggatgaagtgattggc
ttagccaatgattgccagtacggtttgacctcgtcgatttacacgcaaaatctcgatgtc
gcgatgcgtgcgtgcaaagagatcaaatttggagagacctacatcaatcgtgagaatttt
gaagcgatgcaaggatttcatgcaggatggcgaaaatctggcattggtggagccgatgga
aaacacggacttgaagagttcttacaaaccaaagtcgtttacctgcaatacaacctcaat
aagcaataa

DBGET integrated database retrieval system