KEGG   Sulfurospirillum halorespirans: SHALO_2223Help
Entry
SHALO_2223        CDS       T04475                                 

Definition
(GenBank) 4-hydroxy-2-oxopentanoic acid aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
shal  Sulfurospirillum halorespirans
Pathway
shal00360  Phenylalanine metabolism
shal00362  Benzoate degradation
shal00621  Dioxin degradation
shal00622  Xylene degradation
shal01100  Metabolic pathways
shal01120  Microbial metabolism in diverse environments
shal01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:shal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SHALO_2223
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SHALO_2223
   00622 Xylene degradation
    SHALO_2223
   00621 Dioxin degradation
    SHALO_2223
Enzymes [BR:shal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     SHALO_2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm NeuB ComA
Motif
Other DBs
NCBI-ProteinID: AOO65984
UniProt: A0A1D7TM57
Position
complement(2236104..2237111)
Genome map
AA seq 335 aa AA seqDB search
MTNKINLYDVTLRDGSHAISHQLTISQIEHYTKAIDQTGIYAVEVGHGNGLGASSVLVGK
SQLSDEVLLKTAKSNLEHTKLGIHVIPGFATIKKDIEKALSWGVDIVRVASHCTEADITE
RHLGYVREKGKEAYGLLMMSHMASPETLLDEAIKMQTYGAEAIIILDSAGSYLPDDVKER
ITLLSQNLNVPVGFHAHNNLGLGISNSLVAIEAGAQIIDGATKGFGAGAGNAQLEVLAAV
LQKMNYKTNIDLYKLLDTADIVEKDFIKEPITISSLSIVSAIAGVFSGFAKHVKRVAKEF
NVDPRDIFMELGRQKVVAGQEDTIIDIALKLQKRI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaaatcaatctttatgatgtgacattaagagatggttctcatgctatttct
catcaacttactatttcacaaatagagcactatacaaaggcgatagatcaaacaggaata
tatgccgtagaagttggacatggtaatggattaggtgcatcctctgttcttgttggaaaa
agccagttaagtgatgaagttcttcttaaaactgccaaaagtaatttagagcatacaaaa
ttgggaattcatgttatacctggatttgcaaccattaaaaaggatatagaaaaagctctg
tcttggggcgttgatattgtgcgagttgcgagtcattgtacagaagcagatatcactgag
cgccatcttggttatgttcgggaaaaaggtaaagaagcttatggccttttaatgatgagt
catatggcaagtccagaaactttacttgatgaagcaattaagatgcaaacatatggagct
gaagcaatcattatcttagattctgcaggtagctatttgcctgatgatgttaaagaaaga
attactctcttatcacaaaatctaaatgttcctgtcggttttcatgctcataataattta
ggcttaggaatttcaaactcccttgttgctattgaagcaggagcacaaattatagatggt
gcaacgaaaggttttggtgcaggcgcgggaaatgcacagctagaagttttagctgcagta
cttcaaaaaatgaattataagacaaatattgatttatataagctattggatacggctgat
atagtagaaaaggattttataaaagagcccattacgatttcatcattgagtattgttagt
gcaatagctggtgttttttcagggtttgcaaaacatgttaaaagagttgctaaagaattt
aatgtagatccacgcgatatttttatggagcttggacggcaaaaagtagttgctggacaa
gaagatactataattgatatcgcacttaaattgcaaaaaaggatttga

DBGET integrated database retrieval system