KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0178Help
Entry
SU5_0178          CDS       T02011                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00010  Glycolysis / Gluconeogenesis
shb00051  Fructose and mannose metabolism
shb00562  Inositol phosphate metabolism
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
shb01120  Microbial metabolism in diverse environments
shb01130  Biosynthesis of antibiotics
shb01200  Carbon metabolism
shb01230  Biosynthesis of amino acids
Module
shb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
shb_M00002  Glycolysis, core module involving three-carbon compounds
shb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SU5_0178
   00051 Fructose and mannose metabolism
    SU5_0178
   00562 Inositol phosphate metabolism
    SU5_0178
Enzymes [BR:shb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SU5_0178
Exosome [BR:shb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SU5_0178
  Exosomal proteins of bladder cancer cells
   SU5_0178
  Exosomal proteins of melanoma cells
   SU5_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: AFH43558
Position
complement(200682..201449)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIM
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtggctaacctgcgtaaagaactgacgggcgtagcaggctgcgacgtggcaatc
gctccgccggaaatgtatatcgatctggcgaaacgcgctgctgccggcagccacatcatg
ctgggcgcgcagaacgttgatctgaatctgtctggcgcattcaccggtgaaacttcggct
gaaatgctgaaggatatcggcgcgcagtacattattatcggccactccgagcgtcgtact
tatcacaaagaatctgacgagctgatcgccaaaaaattcgccgtactgaaagaacaaggt
ctgacgccggtactgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaa
gaagtatgcgcacgccagatcgacgcggtactgaaaacgcagggcgcggcagcctttgaa
ggcgcggttatcgcttacgaacccgtatgggcgatcggtaccggtaaatctgcaacgcct
gcgcaggcgcaggcagtgcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgaacaggttattatccagtacggcggttctgttaatgcctccaacgccgccgaa
ctgttcgcgcagccggacatcgacggcgcactggtaggcggcgcttctctgaaagctgac
gccttcgcggtgatcgtgaaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system