KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01835Help
Entry
SU5_01835         CDS       T02011                                 

Definition
(GenBank) Beta N-acetyl-glucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00520  Amino sugar and nucleotide sugar metabolism
shb01100  Metabolic pathways
shb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:shb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SU5_01835
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SU5_01835
Enzymes [BR:shb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SU5_01835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AFH45197
Structure
PDB: 

Position
2028053..2029078
Genome map
AA seq 341 aa AA seqDB search
MGPVMLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETP
CDPRPETDIRGKDMSVFRTLISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagata
ctggcgcatccgctggttggcgggcttattctgttcacgcgtaattaccatgacccggaa
cagctgcgcgaattagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggcc
gtcgatcaggaaggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcg
gcgcaatctttttttgcgctgcatgggctggaagagggggggcgactggcgcaggaggca
gggtggctgatggccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtg
ctggacgtcgggcatatcagcgcggcaattggcgagcgctcctatcatgccgatcccgca
aaagcgttggcaatggcaacgcgctttattgacggcatgcatgacgccgggatgaaaacg
accggtaagcatttccccggccacggcgcagtcacggcggactcccacaaagagacgccg
tgcgatccacgtcctgaaacggacatccgtggcaaagatatgtcggtgttccgcacgctg
attagcgagaataaactggatgcgattatgcctgcccacgtgatctaccgcgctatcgat
ccacgcccggcaagtggttcgccgtactggctgaaaacggtgctgcgtcaggagttaggc
tttgacggcgtcattttctccgacgatctgtctatggagggcgcggcgattatgggcagc
tatgctgagcgcgctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaat
aatcgtaaaggcgcagtcagcgtgctggataatctgtcgccgatcaaagcagaacgtgtt
acacgtttgtatcataaaggttcattttcacgccgggagctcatggactcagcacgctgg
aaaacagccagcgcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggt
cattaa

DBGET integrated database retrieval system