KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_02134Help
Entry
SU5_02134         CDS       T02011                                 

Definition
(GenBank) Succinate-semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00250  Alanine, aspartate and glutamate metabolism
shb00650  Butanoate metabolism
shb00760  Nicotinate and nicotinamide metabolism
shb01100  Metabolic pathways
shb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SU5_02134
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SU5_02134
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SU5_02134
Enzymes [BR:shb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SU5_02134
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     SU5_02134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSD4
Motif
Other DBs
NCBI-ProteinID: AFH45493
Structure
PDB: 

Position
2337833..2339221
Genome map
AA seq 462 aa AA seqDB search
MTMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDI
GQALRAHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNPEPTLVENQQA
VIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILTEAG
TPAGVYGWVNANNEGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKIGDP
LVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVTPDMT
AFRQELFGPVAAITVAKDAAHALVLANDSEFGLSATIFTADDTLAAEMAARLECGGVFIN
GYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatgactgcaacacaggcgttatccgtgaatcctgcgaccggccagacgctg
gcggcaatgccctgggctaacgcgcaagagattgaacatgcgctgagtctggcggcgagc
ggtttcaaaaagtggaaaatgacatcggtagcgcaacgggcgcaaacattacgtgatatt
ggtcaggcgcttcgcgctcatgcagaagagatggcgcaatgtattacgcgtgaaatgggt
aaacccataaagcaggcgcgtgcggaagtgacaaaatccgccgcgttatgcgactggtat
gcggaacatggcccggcaatgctgaatcctgagcctacgctggtagaaaatcagcaggcg
gtgattgaataccgtccgctgggcgtcattctggcgataatgccgtggaattttccttta
tggcaggtgttacgcggggcagtgccgatactgttggcggggaatagctacttgttaaaa
catgcgcccaatgtcacgggttgcgcgcagatgatagcccgaatcttgacggaagccggt
actcccgctggcgtctatggatgggtgaacgccaataatgagggcgtgagtcagatgatt
aacgatccgcgaatcgcggcggtgacggtgaccggtagcgtgcgcgccggcgcggcgatt
ggcgctcaggctggggcggcgctgaaaaagtgcgtactggaactgggtggctcggatccg
tttattgtactcaatgatgccgatctcgagctggcggtaaaagccgcggttgccggacgc
tatcaaaacaccggacaagtctgcgccgccgccaaacgttttattgtcgaagagggcatt
gcgcaggcgtttaccgatcgctttgtggcggctgccgcagcattaaagataggtgatcct
ctggttgaagagaatgacctggggccgatggcgcgctttgatttgcgtgatgaactccat
caacaggtgcaggcttccgtcgccgaaggcgcacggctactgttgggcggggagaaaatc
gccggggagggcaactattatgccgcgaccgttctggcggatgtcacacctgacatgact
gcatttcgtcaggagctttttgggcctgttgccgccattaccgttgcaaaagatgcggcg
cacgccctcgtgctggcgaatgacagtgagtttggcctgtcggcgacgatctttaccgcc
gacgatacgctggccgcggagatggcggcgcgtcttgagtgcggtggggtattcattaat
ggttacagcgccagcgatgcgcgtgtggcattcggcggggtgaagaaaagcggcttcggt
cgcgagctttcgcactttggtttacacgaattttgtaatgtgcagaccgtctggaagaac
cgcgtctaa

DBGET integrated database retrieval system