KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_028Help
Entry
SU5_028           CDS       T02011                                 

Definition
(GenBank) Peptidyl-prolyl cis-trans isomerase ppiC
  KO
K03769  peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
KEGG Orthology (KO) [BR:shb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:shb03110]
    SU5_028
Enzymes [BR:shb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SU5_028
Chaperones and folding catalysts [BR:shb03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    SU5_028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-ProteinID: AFH43410
Position
complement(35158..35439)
Genome map
AA seq 93 aa AA seqDB search
MAKMAAALHILVKEEKLALDLLEQIKNGGDFEKLAKKHSICPSGKKGGHLGEFRQGQMVP
AFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRK
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatggcagcagcactgcatattcttgtaaaagaagagaaactggctttagat
cttctggagcaaattaaaaacggcggcgattttgagaagctggcgaagaagcattctatc
tgcccatccggtaaaaaaggcggtcatttaggcgaatttcgtcagggccagatggttccg
gcattcgataaagtagtcttttcctgcccggtactggagccaaccggcccgctgcatacc
cagttcggttaccacatcattaaggtattgtatcgtaaataa

DBGET integrated database retrieval system