KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_02931Help
Entry
SU5_02931         CDS       T02011                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00430  Taurine and hypotaurine metabolism
shb00620  Pyruvate metabolism
shb00640  Propanoate metabolism
shb00680  Methane metabolism
shb01100  Metabolic pathways
shb01120  Microbial metabolism in diverse environments
shb01200  Carbon metabolism
Module
shb_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:shb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SU5_02931
   00640 Propanoate metabolism
    SU5_02931
  09102 Energy metabolism
   00680 Methane metabolism
    SU5_02931
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SU5_02931
Enzymes [BR:shb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SU5_02931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFH46271
Structure
PDB: 

Position
3180806..3182008
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYATKEDAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagttcttcactgaaatttgcaatt
attgatgcagttaatggtgatgaatacctttctggtttagccgaatgtttccatctgcca
gaagcacgcatcaaatggaaaatggacggcagtaaacaagaagcggctttaggtgcaggc
gccgctcacagtgaagcgctgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgcgcagttaactgcaattggtcaccgtatcgtacacggcggcgagaagtatacc
agctccgtagtcattgatgagtccgtcattcagggcatcaaagattccgcctctttcgca
ccgctgcataacccggctcacctgattggtatcgccgaagcgctgaaatctttcccgcag
ctgaaagataaaaacgttgcagtattcgacaccgccttccatcagaccatgccggaagaa
tcttacctgtatgccctgccgtacagcctgtataaagaacacggcgttcgtcgctatggc
gcacacggcaccagccacttctatgtgactcaggaagcggcaaaaatgctgaacaagccg
gtagaagaactgaacattattacctgccacctgggcaacggcggttctgtttccgctatc
cgtaacggtaaatgcgtggatacctctatgggtctgaccccgctggaaggcctggtcatg
ggtacccgttccggcgatatcgaccctgcgattatcttccacctgcacgacactctgggc
atgagcgtggatcagatcaacaaaatgctgaccaaagagtccggtctgctgggtctgact
gaagtgaccagcgactgccgttatgttgaagacaactacgccaccaaagaagacgcaaaa
cgtgcgatggacgtttactgccaccgcctggcgaaatacatcggttcttacaccgctctg
atggacggtcgtctggatgcagtcgtgttcaccggcggtatcggtgaaaacgccgcgatg
gttcgcgagctgtctctgggtaaactgggcgtgctgggctttgaagtcgaccacgaacgt
aacctggcggcccgcttcggcaaatctggtttcatcaacaaagaaggtacccgtccggcg
gtggtgatcccaaccaacgaagaactggttatcgcgcaagacgcgagccgtctgactgcc
tga

DBGET integrated database retrieval system