KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_02946Help
Entry
SU5_02946         CDS       T02011                                 

Definition
(GenBank) Histidine ABC transporter, ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:shb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SU5_02946
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shb02000]
    SU5_02946
Enzymes [BR:shb01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     SU5_02946
Transporters [BR:shb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    SU5_02946
   Histidine transporter
    SU5_02946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 ABC_ATPase AAA_13 AAA_16 AAA_23 G-alpha PRK AAA_33 cobW RsgA_GTPase AAA_24 NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: AFH46286
Structure
PDB: 

Position
complement(3194998..3195774)
Genome map
AA seq 258 aa AA seqDB search
MMSENKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSE
GAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQ
VLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEP
TSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQV
FGNPQSPRLQQFLKGSLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagaaaataaattacacgttatcgatttgcacaaacgctacggcggtcatgaa
gtgctgaaaggggtatcgctgcaggcccgcgccggagatgtgattagcatcatcggctcg
tccggctccggtaaaagcacttttttgcgctgtattaacttcctcgaaaaaccgagcgaa
ggcgcgattatcgtgaacggtcagaacattaatctggtgcgcgacaaagacgggcagctc
aaagtggcggataaaaatcagctacgcttgttgcgtacccgcctgacgatggtgtttcag
cactttaacctctggagccacatgacggtgctggaaaatgtgatggaagcgccgattcag
gtactgggattaagcaagcacgacgcgcgcgagcgggcgttgaaatatctggcgaaggtg
gggattgatgagcgcgctcagggcaaatatcccgtccatctctccggcggccaacagcag
cgcgtttctattgcgcgcgcgctggcgatggaacctgacgttttactgttcgatgaaccc
acatcggcgctcgatcctgaactggtcggcgaagtgttgcgcatcatgcaacaactggcg
gaagaaggcaaaacgatggtggtggtcacgcatgaaatgggcttcgcccgccatgtctct
tcgcacgttatttttctgcatcaggggaaaattgaagaagagggcgatccggagcaggtg
ttcggcaatccgcaaagcccgcgtttacagcaattcctgaaaggctcgctgaaataa

DBGET integrated database retrieval system