KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_03629
Entry
SU5_03629         CDS       T02011                                 

Definition
(GenBank) DUF796 cytoplasmic protein USSDB7A
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:shb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SU5_03629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shb02044]
    SU5_03629
Secretion system [BR:shb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SU5_03629
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFH46954
Position
complement(3971698..3972183)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIEWQITAEKSDGAQQESRTSVWDLAMNQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgcgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
accgcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcgaatggcaaatcactgccgagaaatca
gacggcgctcagcaggagtccagaacgtcagtatgggatctggcgatgaaccagataggg
aaatga

DBGET integrated database retrieval system