KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0788Help
Entry
SU5_0788          CDS       T02011                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00010  Glycolysis / Gluconeogenesis
shb00020  Citrate cycle (TCA cycle)
shb00620  Pyruvate metabolism
shb01100  Metabolic pathways
shb01110  Biosynthesis of secondary metabolites
shb01120  Microbial metabolism in diverse environments
shb01130  Biosynthesis of antibiotics
shb01200  Carbon metabolism
Module
shb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SU5_0788
   00020 Citrate cycle (TCA cycle)
    SU5_0788
   00620 Pyruvate metabolism
    SU5_0788
Enzymes [BR:shb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SU5_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: AFH44159
Position
908787..910676
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPTAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVTAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPA
AKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAG
EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgttgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaaccgagaccggtgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcacctgctaaggcagaagagaagaaagaagcggctccgacagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgtagaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagttcctgctccgtttgcaggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtctctaccggctctctgattatggtcttcgaagtggcg
ggtgaagcaggcgcagcagcaccagcgaaagcggaagccgctccggctgcggctgctcca
gcagcagcgacgggcgtgaaagacgttaacgtaccggacatcggcggcgacgaagttgaa
gtcaccgaagtgatggtcaaagtcggcgataaagttaccgctgaacagtcgctgatcacc
gtagaaggcgacaaagcctctatggaagttccggctccgttcgcgggtaccgtgaaagaa
atcaagatcagcaccggcgataaagtgaaaaccggttctctgattatggtcttcgaagta
gaaggcgcagcgcctgcggccgctccggctaaacaggaagcggcggcgccggctccggcg
gcgaaagctgagaagcctgctgccccggctgcaaaagcggaaggcaaatctgagttcgct
gaaaacgacgcgtacgttcacgctactccgctgattcgccgtctggcgcgcgagtttggc
gtcaacctggcgaaagtgaaaggcaccggtcgtaaaggccgtattctgcgcgaagacgtt
caggcttacgtgaaagacgctatcaaacgcgcggaagctgcgccggctgctgcgggcggc
ggtatcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaa
gaagtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtg
atgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgt
aaacagcagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtc
ttcatcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctctg
tccgaagacggtcagcgtctgaccctgaagaaatacatcaacatcggcgtggcggttgat
accccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgag
ctgtctcgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggc
gaaatgcagggtggttgcttcactatctccagcatcggcggcctgggaactacccacttc
gcgccgattgttaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatggaa
ccggtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttccttc
gaccaccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatg
ttgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system