KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0908
Entry
SU5_0908          CDS       T02011                                 

Definition
(GenBank) Component of the type VI protein secretion system
  KO
K11902  type VI secretion system protein ImpA
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
KEGG Orthology (KO) [BR:shb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shb02044]
    SU5_0908
Secretion system [BR:shb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SU5_0908
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AFH44277
Position
complement(1047106..1048155)
AA seq 349 aa
MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRL
LTRSKDIRVLILLLRSRIQQAGAQGLAEILTQLAELSVIWSDALHPQLLTGEGASAESIE
DAALARSNALAALLDHEGVMADIRGITLSNSAVLRLQVRDVERALSAPRPADALAPESVR
QQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAPDFSRLRQLLALLPDVVQTTT
PEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISLPHNAEPGPIRDRNDALERLR
CIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtccctgactaaaccggtaagcgcggaacaaccctgcggccccgatccggagtacgac
ccggaatacctgctgctgttcagtcgcgccgccccccaggcggaggcgcaatatggtgat
tttgtcagtacgccggaagccgtgaactggccggaaattgaacgtgatgcgcgccgtctg
ctcacgcgcagtaaggatatccgggtgttgatcctgctgctgcgcagtcgcatccagcag
gctggcgcacagggactggcggaaatactcacacaactggcagaactgagcgtaatctgg
tccgatgcactccatccacagctgcttaccggcgaaggcgcatccgcagaatctattgaa
gatgcggcgctggcgcgcagtaatgccctggcggcgctgctggatcacgaaggcgtgatg
gcagacattcgcggtatcacgctgtcaaacagtgccgtcctgcgcctgcaggtacgggat
gtcgagcgcgcgttatccgcccctcgcccggctgatgcgctggcccccgaatccgtccgc
cagcaactggccgacctcgaagcccgtggggcattaccgctggcggcgtttcgcgaagcg
caggaaagcgcagaacgcctgcaagtgtgggcgcgtgagacattaggcgatctggctcca
gatttttcacgcctgcggcagttgttagcgctgctgcctgacgtggtacagacaaccaca
ccggaaatccctccgtcgccagcgccagtgccagaccccgcaggcacggttatggataat
gccgttccggcacgggcagaggatgtgccgcctgtcaacgcgccacccggtatatccctc
ccacacaatgctgaaccggggccaattcgcgatcgtaatgatgcgctggagcgcctgcgg
tgcattcgtcgctggtttgagagcagtgaacccagtagcccgaccatcccactgttacgc
caggctgaaagactggtgggaaaacggttctcggaggtgatcaatgagatcccggtggag
ttgctggagaagtgggatgccctggagtga

DBGET integrated database retrieval system