KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0914Help
Entry
SU5_0914          CDS       T02011                                 

Definition
(GenBank) ClpB protein
  KO
K11907  type VI secretion system protein VasG
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:shb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SU5_0914
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shb02044]
    SU5_0914
Secretion system [BR:shb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SU5_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 Sigma54_activat AAA_7 NACHT IstB_IS21 TniB AAA_25 Zeta_toxin AAA_18 ATPase_2 Hpr_kinase_C P33MONOX SRP54 AAA_6 AAA_30
Motif
Other DBs
NCBI-ProteinID: AFH44283
Position
1053635..1056274
Genome map
AA seq 879 aa AA seqDB search
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRH
YQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLL
ALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESS
QAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRTMTDILLRRRQNNPLLTGE
AGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAGASMKGEFESRLKGLLEEAG
RSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWSEYKRHIEKDP
ALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALT
ARIFSLNNELTASESRWQRELELVHTLQELRVAESDADDKTTLQQAETALREWQGDAPVV
FPEVSAAVVAAIVADWTGIPAGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTA
RAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAIYGGEQNLVTINMSEFQEAHTVSTLK
GAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVHELFYQVFDKGGMEDGEGTHV
DFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAFLGRVTVIPYL
PLDEPSRGVIARLHLDRLVARMGEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcctgtttcacgcagtgcgttgtatggaaaactggccggcccactattccgg
tcgctggaatcggcaacggcattttgcaaactacgctctaatccctgggttgagctgact
cactggctgcaccagttaacacagcagcccgataacgatattctccacgttcttcggcat
taccagatccctctttctgatgtggagaaagcgttactccggcaactggatatgctgccc
gccggggccagcgccattagtgatttttctcaccatatcgatctcagcgttgaaaaggcc
tggatgctggcgagcgtccgttacggcgataacaaaattcgcagcggctggttgctgctg
gccttgttgaccacgccagaactgcgtcgggtactgagcagtatctgcgcgccgctggcc
acgcttccggttgatgaactgacggaaatactgccctcgttgatcgaaacatcgccggaa
gcgcaggagcgcccttacgacggctccggcctggcatcagccattcccggtgaaagcagt
caggcgattcccaacggcgggcaggacggtaaatccgcgctggcaaaatactgtcaggac
atgacggcacaggcgcgcgacggcaaaatcgacccggtgacggggcgtgagcatgaaatc
cgcaccatgacggatattctgctgcgccgtcgccagaataatccactactgactggtgag
gcgggcgtcgggaaaacggcggtcgtcgaaggttttgccctcgcgattgcgcagggggaa
gtgccgcccgcgctgcgggaagtacggctactggcgctggacgttggcgctctgttggcc
ggagccagcatgaaaggcgagtttgaatcgcgtctgaaagggttactggaagaggccggg
cgctcgccgcagccggttattctgtttgtcgatgaagttcacactctggtgggcgcgggc
ggcgcatccggcacgggcgatgccgctaacctgctgaaaccggcgctggcgcgcggcacc
ctgcggactatcggcgccaccacctggagcgaatacaagcgccatattgagaaagatccg
gcgctgacccggcgttttcaggtgttgcagattgccgaaccggaagagatccccgcaatg
gaaatggtgcgtggtctggtggatacgctggaaaaacaccataacgtactgattctggat
gaggcggtacgtgcggcggtacagctttctcaccgctacattcccgcccggcagttgccg
gataaggccatcagcctgctggataccgccgcggcccgcgtggcgctgacgctgcacacg
ccgcctgccagcgtacagttcctgcgccagcagctaaaagcggcggaaatggaacggtcg
ctgttgcagaagcaggaaaaaatggggattcagtcagatgagcggcgcgatgcgctgacg
gcgcgaattttctcgctcaacaatgaactgactgcatccgaatctcgctggcagcgggag
ctggaactggtacatacgttgcaggaactgcgtgtcgcagagtctgatgctgatgacaaa
accacgctgcaacaggccgaaacggcgctaagggagtggcagggcgacgcgccggtggtg
ttcccggaagtcagcgcggcggttgtcgcggcgattgtcgccgactggaccggtattcct
gccgggcgcatggtgaaagatgaggccagccaggtgctggaactgcctgcccgactggcg
caacgcgttaccgggcaagacggcgcgctggcgcagattggtgaacgtattcagaccgcc
agggcgggactgggcgatccacgcaaaccggtgggcgtgtttatgctggccgggccgtcc
ggtgtcggtaaaaccgaaaccgcgctggcgctggcggaggctatctacggcggtgagcag
aacctggtaaccatcaatatgagcgagttccaggaggctcacaccgtttccacgctgaaa
ggcgcgccccccggctatgtgggctatggcgagggtggtgtgctgacggaagcagtgcgt
cgccacccctggagcgtagtgctgctcgacgagatcgaaaaagcgcaccatgacgtccat
gaactcttctatcaggtgtttgacaagggcgggatggaggacggtgagggaacacatgtc
gatttcaaaaacaccacgctattactcaccaccaacgtgggttccgacctcatcagccag
atgtgtgaagatccggccttaatgcccgatgctacggggcttaaagaggcgctaatgccg
gaattgcgcaagcatttcccggcggcatttctgggccgcgtgacggtgatcccttacctg
ccgctggatgaaccgtcgcgtggcgtgattgcccgtctgcaccttgaccggctggtggcg
cggatgggtgaacagcacggcgtgacgctgacgtatagcgaggaactggtcgcacatatt
gtggcgtgctgtccaatgcatgaaacgggcgcgcggttgctgattggctacatcgaacag
cacattctgccacgactgtcgcgctactggttgcaggccatgacggaaaaagccgctatc
aggcagattgatatcggcgttaatggtgatgagcagattgtttttgagatcgtttgctga

DBGET integrated database retrieval system