KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0916
Entry
SU5_0916          CDS       T02011                                 

Definition
(GenBank) Type VI protein secretion system
  KO
K11900  type VI secretion system protein ImpC
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
KEGG Orthology (KO) [BR:shb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shb02044]
    SU5_0916
Secretion system [BR:shb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SU5_0916
SSDB
Motif
Pfam: VipB VipB_2 Pro_3_hydrox_C
Other DBs
NCBI-ProteinID: AFH44285
Position
1056940..1058448
AA seq 502 aa
MANSNMQATDAVAQDTVSASGEFDTLLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITV
SDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFM
NLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLL
GSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSR
YIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAAYAMGVNINRSFKHYG
WCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKN
SDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQ
LEGLTGSLRLVTKLPSVKQGNA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcaaacagtaatatgcaggcaaccgacgcggttgctcaggataccgtctccgcatcc
ggtgaatttgatacgttgctgaatcaggccttccgacccaagactacccaggcggcaaaa
gccgtggaagccgcggtgcagacgctggcgcaacaggcgctggcgaacacgatcaccgtc
agcgatgacgcctataaaagcatcagcgctattattgcgcagatcgactttaaactgacc
gaacagatcaaactgatcctgcaacatcccgactggcagaagctggaatcctcgtggcgc
ggtatggagcatctggtttacaacaccgagaccgacgaaaagctgaaaattcgcttcatg
aatctgtcaaaagatgaattgcggcgcaacatgaagcgttacaagggcatcgcctgggat
caaagcccgatgttcaagaaactgtatgaagccgaatacggccagttaggtggcgaacct
tatggctgtatcattgcggattactacttcgaccatacaccgcccgatgtggatctgctt
ggctctatcgccaaagtcgccgcgtcggcccatgcgccgtttattgccggggcttccccc
tcggtactgcaaatggactcctggcaggaactggcgaatccccgcgacctgaccaaaatc
gtcacccagaacctggaatatgcgccgtggaactcgctgcgggctagcgaagactcccgt
tatattggcctgacgatgccgcgttttcttgcccgcctgccgtatggcgcaaaaaccaac
ccggtggacgagtttgattttgaagaagatgcggatggttctgaccataccaaatacgtc
tggagcaacgcggcctacgcgatgggcgtaaacatcaaccgttccttcaaacactacggc
tggtgtacgttgattcgcggtgtggaatcaggcggtgcggtggaaaatcttccctgccat
accttcccgactgacgatggcggcgtggacatgaaatgcccgaccgaaatcgccatctct
gaccgccgcgaggctgaactggcgaaaaacggttttatcccgttgatccaccgtaaaaac
tcagactatgccgcctttatcggcgcacagtcgctgcaaaaaccacaggaatactacgat
ccggacgcgacggccaacgctaacctgtctgcccgtctaccgtacctgttcgcctgctcg
cgcttcgctcacttcctcaaatgtatcgtccgcgacaaaatcggttcctttaaagagcgt
gaggatatgcagcgctggctaaatgaatggattatgaattatgtcgacgccgatccggtg
aactcctcgcaagaaactaaagcccgtcgtccgctggctgccgctgaagtagtggtggaa
gaggtcgaaggcaatccaggttattacgacgcgaaattcttcctgcgtccgcatttccag
cttgaagggctgacgggatcgctgcgcctggtgacaaaactgccgtcagtgaagcagggc
aatgcctga

DBGET integrated database retrieval system