KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0918Help
Entry
SU5_0918          CDS       T02011                                 

Definition
(GenBank) Hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:shb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SU5_0918
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shb02044]
    SU5_0918
Secretion system [BR:shb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SU5_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFH44287
Structure
PDB: 

Position
1059536..1060021
Genome map
AA seq 161 aa AA seqDB search
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgacatttttctgaaaattgacggcatcgacggtgagtcgatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatatccatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcaccaacctggattttgatcac
tatatcgaccgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtagagctttctttcagcactgtgaaacaggaatacgtggtgcagaac
cagcagggcggcagcggcggcactatcaccgcaggttacgatttcaaggcgaacaaagaa
atttaa

DBGET integrated database retrieval system