KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0923
Entry
SU5_0923          CDS       T02011                                 

Definition
(GenBank) Type VI secretion protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
KEGG Orthology (KO) [BR:shb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shb02044]
    SU5_0923
Secretion system [BR:shb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SU5_0923
SSDB
Motif
Pfam: T6SS_VasE DALR_1
Other DBs
NCBI-ProteinID: AFH44292
Position
1062413..1063756
AA seq 447 aa
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKL
ILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPES
LARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRI
DIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLTGSDNHGHEAAEVSDYLLL
QILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQTRRPAEYKEYKHLTPYAGL
KSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLAIKASMPTDVL
LQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagctggaatgaccgcgtagtctggagtgaaggacaatttttactgccgcagatgttt
cagcagcaagagcgttatctggaacacgtcatgcattaccgcagcctgccgctgaccccc
tttttctggggattcagccactacaatattgatggcgaagcgctgaacatcggtaaactg
atactgaaagaggcatcagggatttttcctgacggcacgccgtttaacgcaccggaccac
accccgctgccgccgccgctgaccatcctgccggagcacctgaaccagcagatttgtctg
gcggtaccggtacgcgcgccgaacagcgaagaaaccacgtttgacaataacccggaatca
ctggcgcgtttctcggtacatgaacacgacatccgcgacgccaactcgctgggacgtggc
gcgcagttattacagctcagtcatctgcgcctgcggctgctgccggaaaaggctgtgacg
ggcgcctggattggcctgccgttgacccgcatcaccgggttgaaccctgacgggcggata
gatatcgaccacgacctgatcccgcccatcattaattatcaggccagttcactgatgtgt
acctggctgtcgtggatcaacgatctcatccggatgcgggccgattcgctggcggaacgg
ttgaccggcagcgacaaccacggccatgaagcagcggaggtctccgattacctgctgctg
caaattctcaatcgctttgagccgctgctgactcacctggcgaaaaccccgctggccccg
gaagtgttgtatcgctacctgtccgaactggccggggaactctccacctatgtgcgtcca
caaacgcgacggcccgctgaatacaaagagtacaaacacctgacgccctatgccgggttg
aaatcgctggttgatgaggtgcagttcctgctgaacgcggtactgatccggggcgcgcag
cgcatcgagctgaaagaggggacttacggcatcctgaatgcggtggtggctccttccgat
cttgccgatttcagcacgctggtactggcgataaaggcttcaatgccgaccgatgtgcta
ctgcaacattttgccgcccagaccaaaatcgggccatccgatcgcctgccggaactgatc
cgctcgcatctgccggggctggctttgcaggttctgcctgtaccaccgcgccaaatcccg
tttcaggccggatacatctattacgacatccgccgcgagggagcattgtgggaacacatt
gcccgttacggcgggatggccatgcataccgccggggaatttccggggctggagacagaa
ctgtggggagtgcgcgataaatga

DBGET integrated database retrieval system