KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0932
Entry
SU5_0932          CDS       T02011                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:shb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SU5_0932
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shb02044]
    SU5_0932
Secretion system [BR:shb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SU5_0932
SSDB
Motif
Pfam: Phage_GPD Phage_base_V T3SSipB
Other DBs
NCBI-ProteinID: AFH44301
Position
1073584..1075815
AA seq 743 aa
MSFVSTNNKSGIGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEP
SGLVKAAVAAAQAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGE
TLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAA
RVVGHEGRSVTYELRMEPWLKLLTHTSDYKAFQNKSVVDILDEVLAEYPYPVEKRLVESY
PVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISAHKACPDSPLVEWH
QEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETGHATYEHYEWP
GDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLMQ
TLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEI
WTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDP
DLPIIVGRTYNQDTMPPWGLPGAATQSGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAE
KDQRIEVNNNESHWVGNNRVKVIDQSEIATIGAVRDHKVQYDDTSLAGGNKTIQTVKELY
LAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNITATDADGQINTIKGQLDLNMDKREPKV
GTFGESEKTAMAAVIKETFPPKE
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgagttttgtatccacaaataataaatccggtataggagggctgacgacaaccacgccg
ccgataaccggagaaagtggcggtgtcaccgcagattcagtcgccggaagcgtggcagat
gcggcggaagccgccgtggaacaggctgcgggatcgctgtttggcgcattgccggagcca
tcaggactggtgaaagccgcggtggcagcggcgcaggccgccgccgcaggtatggcgcag
gatgcggtatcggccatcgtctccgctgttgcaggcgggccgggggcgcataatgtgacg
gtcagcggcagcgccgtaccgccgggcgcattactgttcgccagcctggacggcggcgaa
acattaagtgaactgttcagctatgtggtacagctaaaaacgcccgacaccctgaatctg
ggctatgtctccccggcggccaacctgccgctcaaaccgatggtgggcaaagatctgtgc
gtcaacatcgaactggatggtggcggtaaacgacatatcagcgggctggtcacggcggcg
cgggtggtgggccatgaagggcgttcggttacctatgagctacgtatggagccgtggctg
aaactgctgacccataccagcgactacaaagcattccagaataaaagcgtggtggatatt
ctggatgaagtgctggcggaatacccctacccggtggaaaagcggctggtggaaagctac
ccggtacgcacctggcaggtgcagtacggtgaaactgattttgattttcttcagcgactg
atgcaggagtggggcatctattggtggtttgagcacagcgaggacagccacacgctggtg
ctggcggatgccatcagcgcccacaaagcatgtccggactcgccgctggtcgagtggcac
caggaagggctgaagctggacaaggagtttatccacactatcacggcaaacgagagtctg
cggactggacagtgggtgctggatgatttcgattttacgaagccacgttcattgctggca
aacacggtggcaaacccgcgtgaaaccggtcatgccacctacgagcattatgagtggccg
ggagactacttcgacaagagtgaaggcgagatgctgacgcgcattcgtatggaagcgcag
cgcagccccggcagtcgggtgctggggggagggaatatccgcacactcatgaccggttat
accttcacgctggaaaactatcccactgccgaagtcaatcaggaatacctgctgatgcag
accttgctgtttgtgcaggacaacgcgcagcacagcgggcaggaccagcactttaccttt
tccacccgttttgaactgcaccccacccgcgaggtgttccgcccgcagcggacggtgagc
aaaccccacaccaaagggccgcagagcgccatcgtcaccggcccggcgggccaggaaatc
tggacggatcagtacgggcgggtaaaggtacagtttggctgggatcgctacggcaaaatg
gatgaaaacagctcttgctggatacgcgtcagctacccatgggcgggcaaaggcttcggg
atgatccagatcccgcgtatcggccaggaagtgctggtggatttcaaaaacggcgatccg
gatctgccgatcatcgtggggcgtacctacaaccaggacaccatgccgccgtggggactg
ccgggcgcggcaacacagagcgggatatacagccacactatcggcggcggaccgaccaat
gccaacgccctgcgttttgaagataaacccggtagtgaagaggtctggctacatgctgaa
aaagatcagcgtattgaagttaataataatgaaagtcactgggtggggaataatcgggtt
aaggtcattgatcagtcagaaatagccactattggcgctgtccgcgaccataaagttcag
tatgacgatacctctctggccggaggaaataaaaccattcagacggtaaaagagttatat
ctggcagcgggtgattctattactctgagttgtggtgacaccgttctgtacatgagcagt
aagggggaattttacgtaacctgtaaaacgttcaatattactgcaacagatgccgatggt
cagattaatactataaaagggcagctggatttaaatatggataaaagagaacccaaagtg
ggaacatttggtgagtcagaaaaaacagcaatggcagcagtaattaaggaaactttccca
cccaaagaatag

DBGET integrated database retrieval system