KEGG   Staphylothermus hellenicus: Shell_0087Help
Entry
Shell_0087        CDS       T01249                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00052  Galactose metabolism
shc00561  Glycerolipid metabolism
shc00600  Sphingolipid metabolism
shc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Shell_0087
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shell_0087
   00600 Sphingolipid metabolism
    Shell_0087
Enzymes [BR:shc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Shell_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C HupE_UreJ_2 OTCace
Motif
Other DBs
NCBI-ProteinID: ADI31235
UniProt: D7DAN8
Position
complement(74980..76383)
Genome map
AA seq 467 aa AA seqDB search
MFVVEKALPESSRIKIGIIGAGSAVWSIPVLIDIMLKKSLANADVYLMDIDLDRLKLVYG
FAKRYAEEIHSTVNFHTTTDRVEAIKDADFVINSAMAMGHSYYERMREISEKHGYYRGIN
SVEWNMVSDYHTIWGYYQFKLAMSIARDIEEYAPNAWLFDVANPVFELATLISRKTKVKI
IGLCHGHMGIKNVIRELKLPQDKVEAEMIGFNHVIWLTKFKVDGEDGYKFLDKWIVTEAE
KYWKKWRETTANPFDIDLSPAAIDMYRNYGLLPIGDTVRGGTWKYHWNLETKKKWYGPYG
GPDSEIGWAMYIAYLKMRLYEIYKAITNASRPLTLLFPPKPSGEQVIEIIDSMVTGTPRT
FQVNVLNNGSIPGIPDNVAVEMPAVIDDKGVHRKTFSPLPSKIQKYVIYPRMMRMEWALE
AFLEGGRDKLFEWLIYDPRTKSTRQVEETIDDLLKMPGNEEMAKHYS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtggttgaaaaagctttgcctgaatcatctaggatcaaaatcggtattataggt
gctggttctgcagtatggtctattcctgtattaatagatataatgttgaagaaaagctta
gccaatgcagacgtgtatctcatggatattgatcttgaccggttaaagcttgtatatgga
tttgctaagagatatgctgaagaaatacattcaacagtaaatttccacacgactactgat
agggtagaagcgatcaaggatgctgatttcgtaataaatagtgctatggctatgggtcat
tcatattatgagagaatgagggagatcagtgagaaacacggatactatagaggaataaat
agtgttgaatggaatatggtgagcgattaccatactatttggggatactaccagttcaaa
ctcgccatgagtattgcaagggatatagaggagtatgctccaaacgcgtggttgtttgat
gtcgctaatccagtatttgaattagcaaccctaattagtagaaaaacaaaagtgaaaata
atcggcttatgccatggacacatggggattaaaaatgttatacgtgaactaaaacttccc
caggataaagtagaagctgaaatgatcgggttcaatcatgtaatttggctaacaaaattc
aaagtagacggcgaagacggctataaattcctggataaatggatagtgacagaagctgaa
aagtactggaagaaatggagggaaacaacagctaatcccttcgacatagacttatcccca
gcagctatagacatgtatagaaactatggcttgctcccaataggagatactgttagagga
ggaacatggaaatatcactggaacctggaaacaaagaagaaatggtacggaccatatgga
ggcccagactctgaaataggctgggcaatgtatattgcttatctaaaaatgagattatac
gaaatctacaaagctataactaatgcatcaagacccttaacactattattcccgcctaaa
cctagtggtgaacaagttattgaaataattgattccatggtgacaggcacacctaggact
tttcaagtcaatgtattaaacaatggatcaatacctggtatacccgataacgtagccgtt
gaaatgccggcagtaatcgatgataaaggtgttcatagaaaaacattttctccattacca
tcaaagatacagaaatacgttatatatcccaggatgatgagaatggaatgggctctagaa
gcctttctagaaggcggtagagataagttatttgagtggctaatatatgatccgagaacc
aagtctactagacaagtagaggaaacaatagatgatctattgaaaatgcctggaaacgaa
gaaatggctaaacactactcataa

DBGET integrated database retrieval system