KEGG   Staphylothermus hellenicus: Shell_1002Help
Entry
Shell_1002        CDS       T01249                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00010  Glycolysis / Gluconeogenesis
shc00020  Citrate cycle (TCA cycle)
shc00620  Pyruvate metabolism
shc00640  Propanoate metabolism
shc00650  Butanoate metabolism
shc00680  Methane metabolism
shc00720  Carbon fixation pathways in prokaryotes
shc01100  Metabolic pathways
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
shc01200  Carbon metabolism
Module
shc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1002
   00020 Citrate cycle (TCA cycle)
    Shell_1002
   00620 Pyruvate metabolism
    Shell_1002
   00640 Propanoate metabolism
    Shell_1002
   00650 Butanoate metabolism
    Shell_1002
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Shell_1002
   00680 Methane metabolism
    Shell_1002
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Shell_1002
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Shell_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADI32107
UniProt: D7D8L1
Position
complement(962163..962738)
Genome map
AA seq 191 aa AA seqDB search
MMLVRYMLEIRWHGRGGQGAWTAANLLAMAAAYDGKHVQSFPAFGPERSGAPILAFTRIS
DEPIDLHSMVYEPDIVIVLDPTLLKNVNVVSGLKKNGLIIVNYEGDTDKLYNMLGIKKDE
YKVVVTPATKLALDILKRPITNTPMIGALIKAAPIVSFESIEKAVKKRFPGSIAEKNIAL
IKEAYKLAKEV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatgttggtgagatatatgcttgagattcgctggcatggtcgtggtggtcagggtgca
tggactgctgccaacttattagcaatggcggctgcatatgatggcaagcatgttcagagt
tttccagcattcggaccggaaagatcaggtgctcctatcctagcatttacacgtattagt
gatgaaccaattgatttacacagcatggtgtatgaacccgacatagtgatcgtactagat
ccgacattattgaagaatgtaaatgtagtgagtggtttaaaaaagaacggattaattatc
gttaactatgaaggcgacacagataaactctataatatgcttggtattaagaaagacgaa
tacaaagtagtggtaacacctgctacaaagctagcactagatattctcaagagacccata
acaaatactcccatgatcggagcattaataaaggctgcgccaatagttagttttgaaagc
atagaaaaagctgtgaaaaagagattccctggctccatagctgagaagaatattgcatta
ataaaagaagcttataagctggctaaggaggtgtaa

DBGET integrated database retrieval system