KEGG   Staphylothermus hellenicus: Shell_1406Help
Entry
Shell_1406        CDS       T01249                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00010  Glycolysis / Gluconeogenesis
shc00071  Fatty acid degradation
shc00350  Tyrosine metabolism
shc00625  Chloroalkane and chloroalkene degradation
shc00626  Naphthalene degradation
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
shc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1406
  Lipid metabolism
   00071 Fatty acid degradation
    Shell_1406
  Amino acid metabolism
   00350 Tyrosine metabolism
    Shell_1406
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Shell_1406
   00626 Naphthalene degradation
    Shell_1406
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Shell_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ADI32495
UniProt: D7D9P9
Position
1355542..1356546
Genome map
AA seq 334 aa AA seqDB search
MKAMVLYEPGPVEKNPLKLSDVDIRDPRGDEVLLEISCCGVCRTDLHIVEGELKPIKLPL
IPGHQVVARVKEVGENVDNVSKGMRVGVPWLYWACGKCKYCRRGLENLCDHALFTGYSVD
GGYAEYMIAKKDFVHPLPNTHDDCKAAPLLCAGAVGYRALRLTGLVDKKEGILGLFGFGA
SAHLILQAAKALGLTVYVFTHTPWKIEYAYKLGADWAGNTKETPPNKLDAAIVFAPVSWV
FIEALKKLDKGGRVVLGEIYMSPIEKLDYKLLWLEREVKTTANVTRRDVREFLDIASKHR
IYPDITIYKLEEANKALQDLKHGKIKGQAVLKIK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccatggttctatatgaacctggacctgtagagaaaaatccgttaaaacttagc
gatgttgatataagggatccacgcggagacgaggtattattagagatatcatgttgtgga
gtttgtagaacagatctacatatagttgagggagaactcaaaccaatcaaactccctctt
atacctggtcaccaagtagtagctcgagtaaaagaggttggggaaaatgttgataatgta
agtaaaggtatgagggtaggagttccctggctttactgggcatgtggaaaatgcaagtat
tgtaggaggggattagaaaacctatgtgatcacgcattattcactggatatagtgttgat
ggaggatatgctgaatacatgattgctaagaaggacttcgtgcacccactcccaaacact
catgacgactgcaaagccgctcctctactatgtgctggcgctgttgggtatagagcccta
cgcttaacagggctagtcgataagaaagaaggcatactgggcttattcggattcggcgca
tcagcacatctaattctacaagctgcaaaagcacttggtttaactgtgtatgttttcaca
catactccatggaagatagagtacgcatataagctcggtgcagattgggctggaaacaca
aaggaaacaccgcctaataaactggatgcagcaatagtgttcgcacctgtatcatgggtc
tttatcgaagcattgaaaaaacttgataagggcggaagagttgttctaggagaaatatat
atgtcgcctattgagaaacttgactataaactactatggctggagagagaagtaaaaaca
acagctaacgttacacgtagagatgtccgggaatttctagatatagcatcaaagcacaga
atataccctgatataacgatttataaattagaagaagccaataaggcgttacaagacctt
aaacatggaaagatcaagggccaagctgttttgaaaataaaataa

DBGET integrated database retrieval system