KEGG   Sulfuritalea hydrogenivorans: SUTH_00071Help
Entry
SUTH_00071        CDS       T03591                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00071  Fatty acid degradation
shd00072  Synthesis and degradation of ketone bodies
shd00280  Valine, leucine and isoleucine degradation
shd00310  Lysine degradation
shd00362  Benzoate degradation
shd00380  Tryptophan metabolism
shd00620  Pyruvate metabolism
shd00630  Glyoxylate and dicarboxylate metabolism
shd00640  Propanoate metabolism
shd00650  Butanoate metabolism
shd00900  Terpenoid backbone biosynthesis
shd01100  Metabolic pathways
shd01110  Biosynthesis of secondary metabolites
shd01120  Microbial metabolism in diverse environments
shd01130  Biosynthesis of antibiotics
shd01200  Carbon metabolism
shd01212  Fatty acid metabolism
shd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUTH_00071
   00630 Glyoxylate and dicarboxylate metabolism
    SUTH_00071
   00640 Propanoate metabolism
    SUTH_00071
   00650 Butanoate metabolism
    SUTH_00071
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SUTH_00071
   00072 Synthesis and degradation of ketone bodies
    SUTH_00071
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SUTH_00071
   00310 Lysine degradation
    SUTH_00071
   00380 Tryptophan metabolism
    SUTH_00071
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SUTH_00071
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SUTH_00071
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SUTH_00071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shd04147]
    SUTH_00071
Enzymes [BR:shd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SUTH_00071
Exosome [BR:shd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUTH_00071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAO27891
UniProt: W0SA85
Position
77231..78532
Genome map
AA seq 433 aa AA seqDB search
MTQFAPVYIVDGARSPFLKSRNVPGPFSASDLATISGRALLARQPFAPEQLDEVIVGCAG
PSVDEVNIGRVIALRLGCGHKVPGWTVMRNCASGMQAIDSAIANIQNGRSQLVMAGGVDA
LSRTPLLYSDSMVLWFSKMAQARTLGARLGMFAKLRPAMLLSPVIGIVKGLTDPVVNLMM
GQTAENLAWKFGISRRQMDAFSVDSHKKVAAAQAAGRFDEIVPLIDTDGKVYAADDGVRH
DSSEQNLAKLKPFFDRKYGKITPGNSSQITDGAAWLLLASSEAVEKYGLQPIGKITDTQW
AGLDPAQMGLGPVHAATPILQRHGLGVNDLDAWEINEAFAAQVMGCIKAWEDPAYCKEQL
GLEAPLGTLDPAKLNVDGGAIALGHPVGASGARIVLHLLHILRRDHDGKRGKRGIATICI
GGGQGGAVLVETV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacccaatttgctcccgtgtatatcgtggatggcgcgcgatcgcccttcctcaaatcg
cgcaacgtaccggggccgttttcggcgtccgaccttgccacgatatccggccgtgccctg
ctggcgcgccagcctttcgcccccgagcagctcgacgaggtgatcgtcggctgtgccggg
ccgagcgtggacgaagtcaacatcggccgcgtcatcgcgctgcgcctcggctgcggccac
aaggtgccgggctggaccgtgatgcgcaactgcgcctcgggcatgcaggccatcgattcg
gccatcgccaacatccagaacggacgctcgcagctggtcatggcgggcggcgtcgatgcg
ctgtcgcgcacgccgctgttgtattccgacagcatggtgctgtggttctcgaagatggcg
caggcgcgcacgctcggcgccaggctcgggatgtttgccaagctgcggccggcgatgctg
ctgagtccggtgatcggcatcgtcaagggcctcaccgatccggtggtgaacctgatgatg
ggccagacggcggaaaacctggcctggaaattcggcatctcgcgccggcagatggacgcg
ttttccgtcgacagccacaagaaggtggccgccgcgcaggccgccggccgcttcgacgaa
atcgtgccgctgatcgacacggacggcaaggtgtatgcggcggacgacggcgtgcgccac
gattcgagcgagcagaacctggccaagctgaagcccttcttcgaccgcaagtacggcaag
atcacgccgggcaacagctcgcagatcaccgacggcgcggcctggctgttgctggcgtca
agcgaggccgtcgagaaatacgggttgcaaccgatcggaaagatcaccgacacgcaatgg
gccggcctcgacccggcgcagatgggcctcggcccggtacatgccgcgacgcccatcctg
cagcgccacggcctgggcgtgaatgacctcgacgcctgggaaatcaacgaagccttcgcc
gcgcaggtgatgggctgcatcaaggcctgggaagatccggcctattgcaaggaacagctc
ggcctcgaggccccactcggcacgctcgacccggcgaagctgaatgtcgatggcggcgcc
atcgcactgggccatccggtcggcgcctcgggcgcgcgcatcgtgctgcacctgctgcac
atcctgcgccgcgaccatgatggcaaacgcggcaagcgcggcatcgccaccatctgcatc
ggcggcgggcagggcggcgcggtgctggtggaaacggtgtag

DBGET integrated database retrieval system