KEGG   Sulfuritalea hydrogenivorans: SUTH_00163Help
Entry
SUTH_00163        CDS       T03591                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00480  Glutathione metabolism
shd00590  Arachidonic acid metabolism
shd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SUTH_00163
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SUTH_00163
Enzymes [BR:shd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SUTH_00163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: BAO27983
UniProt: W0SE16
Position
173249..173728
Genome map
AA seq 159 aa AA seqDB search
MSDLYKLSARRIDGGKQSMKDYKGKVLLIVNTASGCGFTPQYAGLEALWQKYGERGLVVL
GFPCNQFGGQEPGDEAAIGEFCSLTYDVSFPMFAKVDVNGGDTHPIFAFLKKAAPGLLGT
EGIKWNFTKFLVDREGNVVARYASAHKPEDMADDIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttgtacaaactctctgcccgccgtatcgatggcgggaagcagtcgatgaag
gactacaagggcaaggtgctcctgatcgtcaacacggccagcggctgcggcttcaccccg
caatacgccgggctcgaagccttgtggcagaagtacggcgagcgcggcctggtggtgctg
ggttttccctgcaaccagttcggtggccaggagccgggcgacgaagccgccattggtgaa
ttctgcagcctgacctacgacgtgagcttcccgatgttcgccaaggtcgatgtcaatggc
ggggatacccatccgatcttcgccttcctgaaaaaagctgcgccgggcttgctcggcact
gaaggcatcaagtggaatttcaccaaattcctggttgaccgcgaaggcaatgtcgtcgct
cgctatgcatcggcgcacaagccggaagacatggccgacgacatcgaaaagctgctttga

DBGET integrated database retrieval system